Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer

Monoclonal antibodies are important tools for cancer therapy, however, three factors limit their effectiveness: toxicity, poor tumor penetration, and inability to cross the blood-brain barrier. This review discusses the emerging field of stem cell-mediated antibody delivery and how this approach may...

Descripción completa

Detalles Bibliográficos
Autores principales: Frank, Richard T, Najbauer, Joseph, Aboody, Karen S
Formato: Texto
Lenguaje:English
Publicado: Wiley Subscription Services, Inc., A Wiley Company 2010
Materias:
Translational and Clinical Research
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3003900/
https://www.ncbi.nlm.nih.gov/pubmed/21089119
http://dx.doi.org/10.1002/stem.513
_version_ 1782193924342808576
author Frank, Richard T
Najbauer, Joseph
Aboody, Karen S
author_facet Frank, Richard T
Najbauer, Joseph
Aboody, Karen S
author_sort Frank, Richard T
collection PubMed
description Monoclonal antibodies are important tools for cancer therapy, however, three factors limit their effectiveness: toxicity, poor tumor penetration, and inability to cross the blood-brain barrier. This review discusses the emerging field of stem cell-mediated antibody delivery and how this approach may improve antibody therapy of cancer by overcoming these obstacles. STEM CELLS 2010;28:2084–2087
format Text
id pubmed-3003900
institution National Center for Biotechnology Information
language English
publishDate 2010
publisher Wiley Subscription Services, Inc., A Wiley Company
record_format MEDLINE/PubMed
spelling pubmed-30039002010-12-30 Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer Frank, Richard T Najbauer, Joseph Aboody, Karen S Stem Cells Translational and Clinical Research Monoclonal antibodies are important tools for cancer therapy, however, three factors limit their effectiveness: toxicity, poor tumor penetration, and inability to cross the blood-brain barrier. This review discusses the emerging field of stem cell-mediated antibody delivery and how this approach may improve antibody therapy of cancer by overcoming these obstacles. STEM CELLS 2010;28:2084–2087 Wiley Subscription Services, Inc., A Wiley Company 2010-11 /pmc/articles/PMC3003900/ /pubmed/21089119 http://dx.doi.org/10.1002/stem.513 Text en Copyright © 2010 AlphaMed Press http://creativecommons.org/licenses/by/2.5/ Re-use of this article is permitted in accordance with the Creative Commons Deed, Attribution 2.5, which does not permit commercial exploitation.
spellingShingle Translational and Clinical Research
Frank, Richard T
Najbauer, Joseph
Aboody, Karen S
Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title_full Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title_fullStr Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title_full_unstemmed Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title_short Concise Review: Stem Cells As an Emerging Platform for Antibody Therapy of Cancer
title_sort concise review: stem cells as an emerging platform for antibody therapy of cancer
topic Translational and Clinical Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3003900/
https://www.ncbi.nlm.nih.gov/pubmed/21089119
http://dx.doi.org/10.1002/stem.513
work_keys_str_mv AT frankrichardt concisereviewstemcellsasanemergingplatformforantibodytherapyofcancer
AT najbauerjoseph concisereviewstemcellsasanemergingplatformforantibodytherapyofcancer
AT aboodykarens concisereviewstemcellsasanemergingplatformforantibodytherapyofcancer

Ejemplares similares