Cargando…
From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects
One protein in Aedes aegypti, classified into the aromatic amino acid decarboxylase (AAAD) family based on extremely high sequence homology (∼70%) with dopa decarboxylase (Ddc), was biochemically investigated. Our data revealed that this predicted AAAD protein use L-dopa as a substrate, as does Ddc,...
Autores principales: | , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3026038/ https://www.ncbi.nlm.nih.gov/pubmed/21283636 http://dx.doi.org/10.1371/journal.pone.0016124 |
_version_ | 1782196988925706240 |
---|---|
author | Vavricka, Christopher Han, Qian Huang, Yongping Erickson, Sara M. Harich, Kim Christensen, Bruce M. Li, Jianyong |
author_facet | Vavricka, Christopher Han, Qian Huang, Yongping Erickson, Sara M. Harich, Kim Christensen, Bruce M. Li, Jianyong |
author_sort | Vavricka, Christopher |
collection | PubMed |
description | One protein in Aedes aegypti, classified into the aromatic amino acid decarboxylase (AAAD) family based on extremely high sequence homology (∼70%) with dopa decarboxylase (Ddc), was biochemically investigated. Our data revealed that this predicted AAAD protein use L-dopa as a substrate, as does Ddc, but it catalyzes the production of 3,4-dihydroxylphenylacetaldehyde (DHPAA) directly from L-dopa and apparently has nothing to do with the production of any aromatic amine. The protein is therefore named DHPAA synthase. This subsequently led to the identification of the same enzyme in Drosophila melanogaster, Anopheles gambiae and Culex quinquefasciatus by an initial prediction of putative DHPAA synthase based on sequence homology and subsequent verification of DHPAA synthase identity through protein expression and activity assays. DHPAA is highly toxic because its aldehyde group readily reacts with the primary amino groups of proteins, leading to protein crosslinking and inactivation. It has previously been demonstrated by several research groups that Drosophila DHPAA synthase was expressed in tissues that produce cuticle materials and apparent defects in regions of colorless, flexible cuticular structures have been observed in its gene mutants. The presence of free amino groups in proteins, the high reactivity of DHPAA with the free amino groups, and the genetically ascertained function of the Drosophila DHPAA synthase in the formation of colorless, flexible cuticle, when taken together, suggest that mosquito and Drosophila DHPAA synthases are involved in the formation of flexible cuticle through their reactive DHPAA-mediated protein crosslinking reactions. Our data illustrate how a seemingly highly toxic pathway can serve for an important physiological function in insects. |
format | Text |
id | pubmed-3026038 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-30260382011-01-31 From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects Vavricka, Christopher Han, Qian Huang, Yongping Erickson, Sara M. Harich, Kim Christensen, Bruce M. Li, Jianyong PLoS One Research Article One protein in Aedes aegypti, classified into the aromatic amino acid decarboxylase (AAAD) family based on extremely high sequence homology (∼70%) with dopa decarboxylase (Ddc), was biochemically investigated. Our data revealed that this predicted AAAD protein use L-dopa as a substrate, as does Ddc, but it catalyzes the production of 3,4-dihydroxylphenylacetaldehyde (DHPAA) directly from L-dopa and apparently has nothing to do with the production of any aromatic amine. The protein is therefore named DHPAA synthase. This subsequently led to the identification of the same enzyme in Drosophila melanogaster, Anopheles gambiae and Culex quinquefasciatus by an initial prediction of putative DHPAA synthase based on sequence homology and subsequent verification of DHPAA synthase identity through protein expression and activity assays. DHPAA is highly toxic because its aldehyde group readily reacts with the primary amino groups of proteins, leading to protein crosslinking and inactivation. It has previously been demonstrated by several research groups that Drosophila DHPAA synthase was expressed in tissues that produce cuticle materials and apparent defects in regions of colorless, flexible cuticular structures have been observed in its gene mutants. The presence of free amino groups in proteins, the high reactivity of DHPAA with the free amino groups, and the genetically ascertained function of the Drosophila DHPAA synthase in the formation of colorless, flexible cuticle, when taken together, suggest that mosquito and Drosophila DHPAA synthases are involved in the formation of flexible cuticle through their reactive DHPAA-mediated protein crosslinking reactions. Our data illustrate how a seemingly highly toxic pathway can serve for an important physiological function in insects. Public Library of Science 2011-01-24 /pmc/articles/PMC3026038/ /pubmed/21283636 http://dx.doi.org/10.1371/journal.pone.0016124 Text en Vavricka et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Vavricka, Christopher Han, Qian Huang, Yongping Erickson, Sara M. Harich, Kim Christensen, Bruce M. Li, Jianyong From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title | From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title_full | From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title_fullStr | From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title_full_unstemmed | From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title_short | From L-Dopa to Dihydroxyphenylacetaldehyde: A Toxic Biochemical Pathway Plays a Vital Physiological Function in Insects |
title_sort | from l-dopa to dihydroxyphenylacetaldehyde: a toxic biochemical pathway plays a vital physiological function in insects |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3026038/ https://www.ncbi.nlm.nih.gov/pubmed/21283636 http://dx.doi.org/10.1371/journal.pone.0016124 |
work_keys_str_mv | AT vavrickachristopher fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT hanqian fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT huangyongping fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT ericksonsaram fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT harichkim fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT christensenbrucem fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects AT lijianyong fromldopatodihydroxyphenylacetaldehydeatoxicbiochemicalpathwayplaysavitalphysiologicalfunctionininsects |