Cargando…

ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs

BACKGROUND: Duplications are very common in the evolution of plant genomes, explaining the high number of members in plant gene families. New genes born after duplication can undergo pseudogenization, neofunctionalization or subfunctionalization. Rice is a model for functional genomics research, an...

Descripción completa

Detalles Bibliográficos
Autores principales: Ricachenevsky, Felipe K, Sperotto, Raul A, Menguer, Paloma K, Sperb, Edilena R, Lopes, Karina L, Fett, Janette P
Formato: Texto
Lenguaje:English
Publicado: BioMed Central 2011
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3041735/
https://www.ncbi.nlm.nih.gov/pubmed/21266036
http://dx.doi.org/10.1186/1471-2229-11-20
_version_ 1782198469124947968
author Ricachenevsky, Felipe K
Sperotto, Raul A
Menguer, Paloma K
Sperb, Edilena R
Lopes, Karina L
Fett, Janette P
author_facet Ricachenevsky, Felipe K
Sperotto, Raul A
Menguer, Paloma K
Sperb, Edilena R
Lopes, Karina L
Fett, Janette P
author_sort Ricachenevsky, Felipe K
collection PubMed
description BACKGROUND: Duplications are very common in the evolution of plant genomes, explaining the high number of members in plant gene families. New genes born after duplication can undergo pseudogenization, neofunctionalization or subfunctionalization. Rice is a model for functional genomics research, an important crop for human nutrition and a target for biofortification. Increased zinc and iron content in the rice grain could be achieved by manipulation of metal transporters. Here, we describe the ZINC-INDUCED FACILITATOR-LIKE (ZIFL) gene family in plants, and characterize the genomic structure and expression of rice paralogs, which are highly affected by segmental duplication. RESULTS: Sequences of sixty-eight ZIFL genes, from nine plant species, were comparatively analyzed. Although related to MSF_1 proteins, ZIFL protein sequences consistently grouped separately. Specific ZIFL sequence signatures were identified. Monocots harbor a larger number of ZIFL genes in their genomes than dicots, probably a result of a lineage-specific expansion. The rice ZIFL paralogs were named OsZIFL1 to OsZIFL13 and characterized. The genomic organization of the rice ZIFL genes seems to be highly influenced by segmental and tandem duplications and concerted evolution, as rice genome contains five highly similar ZIFL gene pairs. Most rice ZIFL promoters are enriched for the core sequence of the Fe-deficiency-related box IDE1. Gene expression analyses of different plant organs, growth stages and treatments, both from our qPCR data and from microarray databases, revealed that the duplicated ZIFL gene pairs are mostly co-expressed. Transcripts of OsZIFL4, OsZIFL5, OsZIFL7, and OsZIFL12 accumulate in response to Zn-excess and Fe-deficiency in roots, two stresses with partially overlapping responses. CONCLUSIONS: We suggest that ZIFL genes have different evolutionary histories in monocot and dicot lineages. In rice, concerted evolution affected ZIFL duplicated genes, possibly maintaining similar expression patterns between pairs. The enrichment for IDE1 boxes in rice ZIFL gene promoters suggests a role in Zn-excess and Fe-deficiency up-regulation of ZIFL transcripts. Moreover, this is the first description of the ZIFL gene family in plants and the basis for functional studies on this family, which may play important roles in Zn and Fe homeostasis in plants.
format Text
id pubmed-3041735
institution National Center for Biotechnology Information
language English
publishDate 2011
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-30417352011-02-19 ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs Ricachenevsky, Felipe K Sperotto, Raul A Menguer, Paloma K Sperb, Edilena R Lopes, Karina L Fett, Janette P BMC Plant Biol Research Article BACKGROUND: Duplications are very common in the evolution of plant genomes, explaining the high number of members in plant gene families. New genes born after duplication can undergo pseudogenization, neofunctionalization or subfunctionalization. Rice is a model for functional genomics research, an important crop for human nutrition and a target for biofortification. Increased zinc and iron content in the rice grain could be achieved by manipulation of metal transporters. Here, we describe the ZINC-INDUCED FACILITATOR-LIKE (ZIFL) gene family in plants, and characterize the genomic structure and expression of rice paralogs, which are highly affected by segmental duplication. RESULTS: Sequences of sixty-eight ZIFL genes, from nine plant species, were comparatively analyzed. Although related to MSF_1 proteins, ZIFL protein sequences consistently grouped separately. Specific ZIFL sequence signatures were identified. Monocots harbor a larger number of ZIFL genes in their genomes than dicots, probably a result of a lineage-specific expansion. The rice ZIFL paralogs were named OsZIFL1 to OsZIFL13 and characterized. The genomic organization of the rice ZIFL genes seems to be highly influenced by segmental and tandem duplications and concerted evolution, as rice genome contains five highly similar ZIFL gene pairs. Most rice ZIFL promoters are enriched for the core sequence of the Fe-deficiency-related box IDE1. Gene expression analyses of different plant organs, growth stages and treatments, both from our qPCR data and from microarray databases, revealed that the duplicated ZIFL gene pairs are mostly co-expressed. Transcripts of OsZIFL4, OsZIFL5, OsZIFL7, and OsZIFL12 accumulate in response to Zn-excess and Fe-deficiency in roots, two stresses with partially overlapping responses. CONCLUSIONS: We suggest that ZIFL genes have different evolutionary histories in monocot and dicot lineages. In rice, concerted evolution affected ZIFL duplicated genes, possibly maintaining similar expression patterns between pairs. The enrichment for IDE1 boxes in rice ZIFL gene promoters suggests a role in Zn-excess and Fe-deficiency up-regulation of ZIFL transcripts. Moreover, this is the first description of the ZIFL gene family in plants and the basis for functional studies on this family, which may play important roles in Zn and Fe homeostasis in plants. BioMed Central 2011-01-25 /pmc/articles/PMC3041735/ /pubmed/21266036 http://dx.doi.org/10.1186/1471-2229-11-20 Text en Copyright ©2011 Ricachenevsky et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Ricachenevsky, Felipe K
Sperotto, Raul A
Menguer, Paloma K
Sperb, Edilena R
Lopes, Karina L
Fett, Janette P
ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title_full ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title_fullStr ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title_full_unstemmed ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title_short ZINC-INDUCED FACILITATOR-LIKE family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (Oryza sativa) paralogs
title_sort zinc-induced facilitator-like family in plants: lineage-specific expansion in monocotyledons and conserved genomic and expression features among rice (oryza sativa) paralogs
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3041735/
https://www.ncbi.nlm.nih.gov/pubmed/21266036
http://dx.doi.org/10.1186/1471-2229-11-20
work_keys_str_mv AT ricachenevskyfelipek zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs
AT sperottoraula zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs
AT menguerpalomak zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs
AT sperbedilenar zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs
AT lopeskarinal zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs
AT fettjanettep zincinducedfacilitatorlikefamilyinplantslineagespecificexpansioninmonocotyledonsandconservedgenomicandexpressionfeaturesamongriceoryzasativaparalogs