Cargando…

Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus

To explore the feasibility of detecting salivary levels of IFN-γ, TNF-α, and sTNFR-2 from erosive oral lichen planus (ELP) patients for clinical application, 20 ELP patients were enrolled in the study as were 20 age-sex-matched controls. From all subjects, saliva level of the tested biomarkers was d...

Descripción completa

Detalles Bibliográficos
Autores principales: Ghallab, Noha A., El-Wakeel, Naglaa, Shaker, Olfat G.
Formato: Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2010
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3042676/
https://www.ncbi.nlm.nih.gov/pubmed/21403886
http://dx.doi.org/10.1155/2010/847632
_version_ 1782198560808239104
author Ghallab, Noha A.
El-Wakeel, Naglaa
Shaker, Olfat G.
author_facet Ghallab, Noha A.
El-Wakeel, Naglaa
Shaker, Olfat G.
author_sort Ghallab, Noha A.
collection PubMed
description To explore the feasibility of detecting salivary levels of IFN-γ, TNF-α, and sTNFR-2 from erosive oral lichen planus (ELP) patients for clinical application, 20 ELP patients were enrolled in the study as were 20 age-sex-matched controls. From all subjects, saliva level of the tested biomarkers was determined by ELISA. Salivary profiles were assessed in ELP patients by ELISA after being treated with prednisone. A significantly higher level of IFN-γ (P ≤ .01), TNF-α (P ≤ .0001), and sTNFR-2 (P ≤ .01) was detected in ELP patients before treatment than in controls. Following treatment, the salivary levels of IFN-γ (P ≤ .01), TNF-α (P ≤ .05), and sTNFR-2 (P ≤ .01) decreased significantly when compared to their pretreatment levels. This study demonstrated that salivary IFN-γ, TNF-α, and sTNFR-2 can be detectable in ELP patients and decreased significantly after treatment with prednisone, which may reveal the possibility of using these disease-related biomarkers in diagnosis and monitoring.
format Text
id pubmed-3042676
institution National Center for Biotechnology Information
language English
publishDate 2010
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-30426762011-03-14 Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus Ghallab, Noha A. El-Wakeel, Naglaa Shaker, Olfat G. Mediators Inflamm Clinical Study To explore the feasibility of detecting salivary levels of IFN-γ, TNF-α, and sTNFR-2 from erosive oral lichen planus (ELP) patients for clinical application, 20 ELP patients were enrolled in the study as were 20 age-sex-matched controls. From all subjects, saliva level of the tested biomarkers was determined by ELISA. Salivary profiles were assessed in ELP patients by ELISA after being treated with prednisone. A significantly higher level of IFN-γ (P ≤ .01), TNF-α (P ≤ .0001), and sTNFR-2 (P ≤ .01) was detected in ELP patients before treatment than in controls. Following treatment, the salivary levels of IFN-γ (P ≤ .01), TNF-α (P ≤ .05), and sTNFR-2 (P ≤ .01) decreased significantly when compared to their pretreatment levels. This study demonstrated that salivary IFN-γ, TNF-α, and sTNFR-2 can be detectable in ELP patients and decreased significantly after treatment with prednisone, which may reveal the possibility of using these disease-related biomarkers in diagnosis and monitoring. Hindawi Publishing Corporation 2010 2011-02-13 /pmc/articles/PMC3042676/ /pubmed/21403886 http://dx.doi.org/10.1155/2010/847632 Text en Copyright © 2010 Noha A. Ghallab et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Clinical Study
Ghallab, Noha A.
El-Wakeel, Naglaa
Shaker, Olfat G.
Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title_full Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title_fullStr Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title_full_unstemmed Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title_short Levels of Salivary IFN-gamma, TNF-Alfa, and TNF Receptor-2 As Prognostic Markers in (Erosive) Oral Lichen Planus
title_sort levels of salivary ifn-gamma, tnf-alfa, and tnf receptor-2 as prognostic markers in (erosive) oral lichen planus
topic Clinical Study
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3042676/
https://www.ncbi.nlm.nih.gov/pubmed/21403886
http://dx.doi.org/10.1155/2010/847632
work_keys_str_mv AT ghallabnohaa levelsofsalivaryifngammatnfalfaandtnfreceptor2asprognosticmarkersinerosiveorallichenplanus
AT elwakeelnaglaa levelsofsalivaryifngammatnfalfaandtnfreceptor2asprognosticmarkersinerosiveorallichenplanus
AT shakerolfatg levelsofsalivaryifngammatnfalfaandtnfreceptor2asprognosticmarkersinerosiveorallichenplanus