Cargando…

Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava

The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Eu...

Descripción completa

Detalles Bibliográficos
Autores principales: Goldstien, Sharyn J., Dupont, Lise, Viard, Frédérique, Hallas, Paul J., Nishikawa, Teruaki, Schiel, David R., Gemmell, Neil J., Bishop, John D. D.
Formato: Texto
Lenguaje:English
Publicado: Public Library of Science 2011
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3043059/
https://www.ncbi.nlm.nih.gov/pubmed/21364988
http://dx.doi.org/10.1371/journal.pone.0016755
_version_ 1782198596477648896
author Goldstien, Sharyn J.
Dupont, Lise
Viard, Frédérique
Hallas, Paul J.
Nishikawa, Teruaki
Schiel, David R.
Gemmell, Neil J.
Bishop, John D. D.
author_facet Goldstien, Sharyn J.
Dupont, Lise
Viard, Frédérique
Hallas, Paul J.
Nishikawa, Teruaki
Schiel, David R.
Gemmell, Neil J.
Bishop, John D. D.
author_sort Goldstien, Sharyn J.
collection PubMed
description The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.
format Text
id pubmed-3043059
institution National Center for Biotechnology Information
language English
publishDate 2011
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-30430592011-03-01 Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava Goldstien, Sharyn J. Dupont, Lise Viard, Frédérique Hallas, Paul J. Nishikawa, Teruaki Schiel, David R. Gemmell, Neil J. Bishop, John D. D. PLoS One Research Article The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world. Public Library of Science 2011-02-22 /pmc/articles/PMC3043059/ /pubmed/21364988 http://dx.doi.org/10.1371/journal.pone.0016755 Text en Goldstien et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Goldstien, Sharyn J.
Dupont, Lise
Viard, Frédérique
Hallas, Paul J.
Nishikawa, Teruaki
Schiel, David R.
Gemmell, Neil J.
Bishop, John D. D.
Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title_full Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title_fullStr Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title_full_unstemmed Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title_short Global Phylogeography of the Widely Introduced North West Pacific Ascidian Styela clava
title_sort global phylogeography of the widely introduced north west pacific ascidian styela clava
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3043059/
https://www.ncbi.nlm.nih.gov/pubmed/21364988
http://dx.doi.org/10.1371/journal.pone.0016755
work_keys_str_mv AT goldstiensharynj globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT dupontlise globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT viardfrederique globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT hallaspaulj globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT nishikawateruaki globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT schieldavidr globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT gemmellneilj globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
AT bishopjohndd globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava