Cargando…
A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function
BACKGROUND: Ceramide kinase (CERK) is a key regulator of cell survival in dicotyledonous plants and animals. Much less is known about the roles of CERK and ceramides in mediating cellular processes in monocot plants. Here, we report the characterization of a ceramide kinase, OsCERK, from rice (Oryza...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3069040/ https://www.ncbi.nlm.nih.gov/pubmed/21483860 http://dx.doi.org/10.1371/journal.pone.0018079 |
_version_ | 1782201309961650176 |
---|---|
author | Bi, Fang-Cheng Zhang, Quan-Fang Liu, Zhe Fang, Ce Li, Jian Su, Jian-Bin Greenberg, Jean T. Wang, Hong-Bin Yao, Nan |
author_facet | Bi, Fang-Cheng Zhang, Quan-Fang Liu, Zhe Fang, Ce Li, Jian Su, Jian-Bin Greenberg, Jean T. Wang, Hong-Bin Yao, Nan |
author_sort | Bi, Fang-Cheng |
collection | PubMed |
description | BACKGROUND: Ceramide kinase (CERK) is a key regulator of cell survival in dicotyledonous plants and animals. Much less is known about the roles of CERK and ceramides in mediating cellular processes in monocot plants. Here, we report the characterization of a ceramide kinase, OsCERK, from rice (Oryza sativa spp. Japonica cv. Nipponbare) and investigate the effects of ceramides on rice cell viability. PRINCIPAL FINDINGS: OsCERK can complement the Arabidopsis CERK mutant acd5. Recombinant OsCERK has ceramide kinase activity with Michaelis-Menten kinetics and optimal activity at 7.0 pH and 40°C. Mg(2+) activates OsCERK in a concentration-dependent manner. Importantly, a CXXXCXXC motif, conserved in all ceramide kinases and important for the activity of the human enzyme, is critical for OsCERK enzyme activity and in planta function. In a rice protoplast system, inhibition of CERK leads to cell death and the ratio of added ceramide and ceramide-1-phosphate, CERK's substrate and product, respectively, influences cell survival. Ceramide-induced rice cell death has apoptotic features and is an active process that requires both de novo protein synthesis and phosphorylation, respectively. Finally, mitochondria membrane potential loss previously associated with ceramide-induced cell death in Arabidopsis was also found in rice, but it occurred with different timing. CONCLUSIONS: OsCERK is a bona fide ceramide kinase with a functionally and evolutionarily conserved Cys-rich motif that plays an important role in modulating cell fate in plants. The vital function of the conserved motif in both human and rice CERKs suggests that the biochemical mechanism of CERKs is similar in animals and plants. Furthermore, ceramides induce cell death with similar features in monocot and dicot plants. |
format | Text |
id | pubmed-3069040 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-30690402011-04-11 A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function Bi, Fang-Cheng Zhang, Quan-Fang Liu, Zhe Fang, Ce Li, Jian Su, Jian-Bin Greenberg, Jean T. Wang, Hong-Bin Yao, Nan PLoS One Research Article BACKGROUND: Ceramide kinase (CERK) is a key regulator of cell survival in dicotyledonous plants and animals. Much less is known about the roles of CERK and ceramides in mediating cellular processes in monocot plants. Here, we report the characterization of a ceramide kinase, OsCERK, from rice (Oryza sativa spp. Japonica cv. Nipponbare) and investigate the effects of ceramides on rice cell viability. PRINCIPAL FINDINGS: OsCERK can complement the Arabidopsis CERK mutant acd5. Recombinant OsCERK has ceramide kinase activity with Michaelis-Menten kinetics and optimal activity at 7.0 pH and 40°C. Mg(2+) activates OsCERK in a concentration-dependent manner. Importantly, a CXXXCXXC motif, conserved in all ceramide kinases and important for the activity of the human enzyme, is critical for OsCERK enzyme activity and in planta function. In a rice protoplast system, inhibition of CERK leads to cell death and the ratio of added ceramide and ceramide-1-phosphate, CERK's substrate and product, respectively, influences cell survival. Ceramide-induced rice cell death has apoptotic features and is an active process that requires both de novo protein synthesis and phosphorylation, respectively. Finally, mitochondria membrane potential loss previously associated with ceramide-induced cell death in Arabidopsis was also found in rice, but it occurred with different timing. CONCLUSIONS: OsCERK is a bona fide ceramide kinase with a functionally and evolutionarily conserved Cys-rich motif that plays an important role in modulating cell fate in plants. The vital function of the conserved motif in both human and rice CERKs suggests that the biochemical mechanism of CERKs is similar in animals and plants. Furthermore, ceramides induce cell death with similar features in monocot and dicot plants. Public Library of Science 2011-03-31 /pmc/articles/PMC3069040/ /pubmed/21483860 http://dx.doi.org/10.1371/journal.pone.0018079 Text en Bi et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Bi, Fang-Cheng Zhang, Quan-Fang Liu, Zhe Fang, Ce Li, Jian Su, Jian-Bin Greenberg, Jean T. Wang, Hong-Bin Yao, Nan A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title | A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title_full | A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title_fullStr | A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title_full_unstemmed | A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title_short | A Conserved Cysteine Motif Is Critical for Rice Ceramide Kinase Activity and Function |
title_sort | conserved cysteine motif is critical for rice ceramide kinase activity and function |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3069040/ https://www.ncbi.nlm.nih.gov/pubmed/21483860 http://dx.doi.org/10.1371/journal.pone.0018079 |
work_keys_str_mv | AT bifangcheng aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT zhangquanfang aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT liuzhe aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT fangce aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT lijian aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT sujianbin aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT greenbergjeant aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT wanghongbin aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT yaonan aconservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT bifangcheng conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT zhangquanfang conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT liuzhe conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT fangce conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT lijian conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT sujianbin conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT greenbergjeant conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT wanghongbin conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction AT yaonan conservedcysteinemotifiscriticalforriceceramidekinaseactivityandfunction |