Cargando…

Normal inflammatory markers in appendicitis: evidence from two independent cohort studies

OBJECTIVES: Acute appendicitis is a common surgical condition which can lead to severe complications. Recent work suggested that patients experiencing right lower abdominal pain, with normal white cell count (WCC) and C-reactive protein (CRP) are unlikely to have acute appendicitis and can be discha...

Descripción completa

Detalles Bibliográficos
Autores principales: Vaughan-Shaw, PG, Rees, JR, Bell, E, Hamdan, M, Platt, T
Formato: Texto
Lenguaje:English
Publicado: Royal Society of Medicine Press 2011
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3105453/
https://www.ncbi.nlm.nih.gov/pubmed/21637404
http://dx.doi.org/10.1258/shorts.2011.010114
_version_ 1782204717376471040
author Vaughan-Shaw, PG
Rees, JR
Bell, E
Hamdan, M
Platt, T
author_facet Vaughan-Shaw, PG
Rees, JR
Bell, E
Hamdan, M
Platt, T
author_sort Vaughan-Shaw, PG
collection PubMed
description OBJECTIVES: Acute appendicitis is a common surgical condition which can lead to severe complications. Recent work suggested that patients experiencing right lower abdominal pain, with normal white cell count (WCC) and C-reactive protein (CRP) are unlikely to have acute appendicitis and can be discharged. We present two independent data-sets that suggest that this strategy may not be risk-free. DESIGN: Retrospective cohort study of consecutive patients from two district general hospitals. Sensitivity and specificity of CRP, WCC and neutrophil count (NC) in predicting appendicitis were calculated. Markers were analysed using Fisher's exact test and Kruskul-Wallace test. SETTING: Two district general hospitals in the UK. PARTICIPANTS: Patients undergoing appendicectomy for suspected appendicitis. MAIN OUTCOME MEASURES: Inflammatory markers and appendix histology. RESULTS: A total of 297 patients were included. Appendicitis occurred in four patients with normal CRP, WCC and NC in centre A and 13 patients in centre B. The sensitivity of all three markers combined was 94% (centre A) and 92% (centre B). The specificity was 60% (centre A) and 64% (centre B). No single marker could differentiate uncomplicated and complicated appendicitis, but a raised NC or a CRP >35.5 mg/l predicted complicated appendicitis. CRP, WCC and NC combined differentiated between patients with a normal appendix, uncomplicated appendicitis and complicated appendicitis. CONCLUSIONS: Appendicitis in the presence of normal inflammatory markers is not uncommon. We disagree with the view of Sengupta et al. who suggest that patients with normal WCC and CRP are unlikely to have appendicitis, and recommend that clinicians be wary of normal inflammatory markers in patients with a high clinical suspicion of appendicitis.
format Text
id pubmed-3105453
institution National Center for Biotechnology Information
language English
publishDate 2011
publisher Royal Society of Medicine Press
record_format MEDLINE/PubMed
spelling pubmed-31054532011-06-02 Normal inflammatory markers in appendicitis: evidence from two independent cohort studies Vaughan-Shaw, PG Rees, JR Bell, E Hamdan, M Platt, T JRSM Short Rep Research OBJECTIVES: Acute appendicitis is a common surgical condition which can lead to severe complications. Recent work suggested that patients experiencing right lower abdominal pain, with normal white cell count (WCC) and C-reactive protein (CRP) are unlikely to have acute appendicitis and can be discharged. We present two independent data-sets that suggest that this strategy may not be risk-free. DESIGN: Retrospective cohort study of consecutive patients from two district general hospitals. Sensitivity and specificity of CRP, WCC and neutrophil count (NC) in predicting appendicitis were calculated. Markers were analysed using Fisher's exact test and Kruskul-Wallace test. SETTING: Two district general hospitals in the UK. PARTICIPANTS: Patients undergoing appendicectomy for suspected appendicitis. MAIN OUTCOME MEASURES: Inflammatory markers and appendix histology. RESULTS: A total of 297 patients were included. Appendicitis occurred in four patients with normal CRP, WCC and NC in centre A and 13 patients in centre B. The sensitivity of all three markers combined was 94% (centre A) and 92% (centre B). The specificity was 60% (centre A) and 64% (centre B). No single marker could differentiate uncomplicated and complicated appendicitis, but a raised NC or a CRP >35.5 mg/l predicted complicated appendicitis. CRP, WCC and NC combined differentiated between patients with a normal appendix, uncomplicated appendicitis and complicated appendicitis. CONCLUSIONS: Appendicitis in the presence of normal inflammatory markers is not uncommon. We disagree with the view of Sengupta et al. who suggest that patients with normal WCC and CRP are unlikely to have appendicitis, and recommend that clinicians be wary of normal inflammatory markers in patients with a high clinical suspicion of appendicitis. Royal Society of Medicine Press 2011-05-25 /pmc/articles/PMC3105453/ /pubmed/21637404 http://dx.doi.org/10.1258/shorts.2011.010114 Text en © 2011 Royal Society of Medicine Press http://creativecommons.org/licenses/by-nc/2.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by-nc/2.0/), which permits non-commercial use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research
Vaughan-Shaw, PG
Rees, JR
Bell, E
Hamdan, M
Platt, T
Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title_full Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title_fullStr Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title_full_unstemmed Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title_short Normal inflammatory markers in appendicitis: evidence from two independent cohort studies
title_sort normal inflammatory markers in appendicitis: evidence from two independent cohort studies
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3105453/
https://www.ncbi.nlm.nih.gov/pubmed/21637404
http://dx.doi.org/10.1258/shorts.2011.010114
work_keys_str_mv AT vaughanshawpg normalinflammatorymarkersinappendicitisevidencefromtwoindependentcohortstudies
AT reesjr normalinflammatorymarkersinappendicitisevidencefromtwoindependentcohortstudies
AT belle normalinflammatorymarkersinappendicitisevidencefromtwoindependentcohortstudies
AT hamdanm normalinflammatorymarkersinappendicitisevidencefromtwoindependentcohortstudies
AT plattt normalinflammatorymarkersinappendicitisevidencefromtwoindependentcohortstudies