Cargando…
Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed t...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3112084/ https://www.ncbi.nlm.nih.gov/pubmed/21548917 http://dx.doi.org/10.1186/1471-2369-12-18 |
_version_ | 1782205693913202688 |
---|---|
author | Zhang, Kunying Liu, Li Cheng, Xuyang Dong, Jie Geng, Qiuming Zuo, Li |
author_facet | Zhang, Kunying Liu, Li Cheng, Xuyang Dong, Jie Geng, Qiuming Zuo, Li |
author_sort | Zhang, Kunying |
collection | PubMed |
description | BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed to test the relationship of plasma vitamin C level and some inflammatory markers. METHODS: In this cross-sectional study, 284 dialysis patients were recruited, including 117 MHD and 167 CAPD patients. The demographics were recorded. Plasma vitamin C was measured by high-performance liquid chromatography. And we also measured body mass index (BMI, calculated as weight/height(2)), Kt/V, serum albumin, serum prealbumin, high-sensitivity C-reactive protein (hsCRP), ferritin, hemoglobin. The relationships between vitamin C and albumin, pre-albumin and hsCRP levels were tested by Spearman correlation analysis and multiple regression analysis. Patients were classified into three subgroups by vitamin C level according to previous recommendation [1,2] in MHD and CAPD patients respectively: group A: < 2 ug/ml (< 11.4 umol/l, deficiency), group B: 2-4 ug/ml (11.4-22.8 umol/l, insufficiency) and group C: > 4 ug/ml (> 22.8 umol/l, normal and above). RESULTS: Patients showed a widely distribution of plasma vitamin C levels in the total 284 dialysis patients. Vitamin C deficiency (< 2 ug/ml) was present in 95(33.45%) and insufficiency (2-4 ug/ml) in 88(30.99%). 73(25.70%) patients had plasma vitamin C levels within normal range (4-14 ug/ml) and 28(9.86%) at higher than normal levels (> 14 ug/ml). The similar proportion of different vitamin C levels was found in both MHD and CAPD groups. Plasma vitamin C level was inversely associated with hsCRP concentration (Spearman r = -0.201, P = 0.001) and positively associated with prealbumin (Spearman r = 0.268, P < 0.001), albumin levels (Spearman r = 0.161, P = 0.007). In multiple linear regression analysis, plasma vitamin C level was inversely associated with log(10)hsCRP (P = 0.048) and positively with prealbumin levels (P = 0.002) adjusted for gender, age, diabetes, modality of dialysis and some other confounding effects. CONCLUSIONS: The investigation indicates that vitamin C deficiency is common in both MHD patients and CAPD patients. Plasma vitamin C level is positively associated with serum prealbumin level and negatively associated with hsCRP level in both groups. Vitamin C deficiency may play an important role in the increased inflammatory status in dialysis patients. Further studies are needed to determine whether inflammatory status in dialysis patients can be improved by using vitamin C supplements. |
format | Online Article Text |
id | pubmed-3112084 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-31120842011-06-11 Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein Zhang, Kunying Liu, Li Cheng, Xuyang Dong, Jie Geng, Qiuming Zuo, Li BMC Nephrol Research Article BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed to test the relationship of plasma vitamin C level and some inflammatory markers. METHODS: In this cross-sectional study, 284 dialysis patients were recruited, including 117 MHD and 167 CAPD patients. The demographics were recorded. Plasma vitamin C was measured by high-performance liquid chromatography. And we also measured body mass index (BMI, calculated as weight/height(2)), Kt/V, serum albumin, serum prealbumin, high-sensitivity C-reactive protein (hsCRP), ferritin, hemoglobin. The relationships between vitamin C and albumin, pre-albumin and hsCRP levels were tested by Spearman correlation analysis and multiple regression analysis. Patients were classified into three subgroups by vitamin C level according to previous recommendation [1,2] in MHD and CAPD patients respectively: group A: < 2 ug/ml (< 11.4 umol/l, deficiency), group B: 2-4 ug/ml (11.4-22.8 umol/l, insufficiency) and group C: > 4 ug/ml (> 22.8 umol/l, normal and above). RESULTS: Patients showed a widely distribution of plasma vitamin C levels in the total 284 dialysis patients. Vitamin C deficiency (< 2 ug/ml) was present in 95(33.45%) and insufficiency (2-4 ug/ml) in 88(30.99%). 73(25.70%) patients had plasma vitamin C levels within normal range (4-14 ug/ml) and 28(9.86%) at higher than normal levels (> 14 ug/ml). The similar proportion of different vitamin C levels was found in both MHD and CAPD groups. Plasma vitamin C level was inversely associated with hsCRP concentration (Spearman r = -0.201, P = 0.001) and positively associated with prealbumin (Spearman r = 0.268, P < 0.001), albumin levels (Spearman r = 0.161, P = 0.007). In multiple linear regression analysis, plasma vitamin C level was inversely associated with log(10)hsCRP (P = 0.048) and positively with prealbumin levels (P = 0.002) adjusted for gender, age, diabetes, modality of dialysis and some other confounding effects. CONCLUSIONS: The investigation indicates that vitamin C deficiency is common in both MHD patients and CAPD patients. Plasma vitamin C level is positively associated with serum prealbumin level and negatively associated with hsCRP level in both groups. Vitamin C deficiency may play an important role in the increased inflammatory status in dialysis patients. Further studies are needed to determine whether inflammatory status in dialysis patients can be improved by using vitamin C supplements. BioMed Central 2011-05-06 /pmc/articles/PMC3112084/ /pubmed/21548917 http://dx.doi.org/10.1186/1471-2369-12-18 Text en Copyright ©2011 Zhang et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Zhang, Kunying Liu, Li Cheng, Xuyang Dong, Jie Geng, Qiuming Zuo, Li Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title | Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title_full | Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title_fullStr | Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title_full_unstemmed | Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title_short | Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein |
title_sort | low levels of vitamin c in dialysis patients is associated with decreased prealbumin and increased c-reactive protein |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3112084/ https://www.ncbi.nlm.nih.gov/pubmed/21548917 http://dx.doi.org/10.1186/1471-2369-12-18 |
work_keys_str_mv | AT zhangkunying lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein AT liuli lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein AT chengxuyang lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein AT dongjie lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein AT gengqiuming lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein AT zuoli lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein |