Cargando…

Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein

BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed t...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Kunying, Liu, Li, Cheng, Xuyang, Dong, Jie, Geng, Qiuming, Zuo, Li
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2011
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3112084/
https://www.ncbi.nlm.nih.gov/pubmed/21548917
http://dx.doi.org/10.1186/1471-2369-12-18
_version_ 1782205693913202688
author Zhang, Kunying
Liu, Li
Cheng, Xuyang
Dong, Jie
Geng, Qiuming
Zuo, Li
author_facet Zhang, Kunying
Liu, Li
Cheng, Xuyang
Dong, Jie
Geng, Qiuming
Zuo, Li
author_sort Zhang, Kunying
collection PubMed
description BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed to test the relationship of plasma vitamin C level and some inflammatory markers. METHODS: In this cross-sectional study, 284 dialysis patients were recruited, including 117 MHD and 167 CAPD patients. The demographics were recorded. Plasma vitamin C was measured by high-performance liquid chromatography. And we also measured body mass index (BMI, calculated as weight/height(2)), Kt/V, serum albumin, serum prealbumin, high-sensitivity C-reactive protein (hsCRP), ferritin, hemoglobin. The relationships between vitamin C and albumin, pre-albumin and hsCRP levels were tested by Spearman correlation analysis and multiple regression analysis. Patients were classified into three subgroups by vitamin C level according to previous recommendation [1,2] in MHD and CAPD patients respectively: group A: < 2 ug/ml (< 11.4 umol/l, deficiency), group B: 2-4 ug/ml (11.4-22.8 umol/l, insufficiency) and group C: > 4 ug/ml (> 22.8 umol/l, normal and above). RESULTS: Patients showed a widely distribution of plasma vitamin C levels in the total 284 dialysis patients. Vitamin C deficiency (< 2 ug/ml) was present in 95(33.45%) and insufficiency (2-4 ug/ml) in 88(30.99%). 73(25.70%) patients had plasma vitamin C levels within normal range (4-14 ug/ml) and 28(9.86%) at higher than normal levels (> 14 ug/ml). The similar proportion of different vitamin C levels was found in both MHD and CAPD groups. Plasma vitamin C level was inversely associated with hsCRP concentration (Spearman r = -0.201, P = 0.001) and positively associated with prealbumin (Spearman r = 0.268, P < 0.001), albumin levels (Spearman r = 0.161, P = 0.007). In multiple linear regression analysis, plasma vitamin C level was inversely associated with log(10)hsCRP (P = 0.048) and positively with prealbumin levels (P = 0.002) adjusted for gender, age, diabetes, modality of dialysis and some other confounding effects. CONCLUSIONS: The investigation indicates that vitamin C deficiency is common in both MHD patients and CAPD patients. Plasma vitamin C level is positively associated with serum prealbumin level and negatively associated with hsCRP level in both groups. Vitamin C deficiency may play an important role in the increased inflammatory status in dialysis patients. Further studies are needed to determine whether inflammatory status in dialysis patients can be improved by using vitamin C supplements.
format Online
Article
Text
id pubmed-3112084
institution National Center for Biotechnology Information
language English
publishDate 2011
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-31120842011-06-11 Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein Zhang, Kunying Liu, Li Cheng, Xuyang Dong, Jie Geng, Qiuming Zuo, Li BMC Nephrol Research Article BACKGROUND: Subclinical inflammation is a common phenomenon in patients on either continuous ambulatory peritoneal dialysis (CAPD) or maintenance hemodialysis (MHD). We hypothesized that vitamin C had anti-inflammation effect because of its electron offering ability. The current study was designed to test the relationship of plasma vitamin C level and some inflammatory markers. METHODS: In this cross-sectional study, 284 dialysis patients were recruited, including 117 MHD and 167 CAPD patients. The demographics were recorded. Plasma vitamin C was measured by high-performance liquid chromatography. And we also measured body mass index (BMI, calculated as weight/height(2)), Kt/V, serum albumin, serum prealbumin, high-sensitivity C-reactive protein (hsCRP), ferritin, hemoglobin. The relationships between vitamin C and albumin, pre-albumin and hsCRP levels were tested by Spearman correlation analysis and multiple regression analysis. Patients were classified into three subgroups by vitamin C level according to previous recommendation [1,2] in MHD and CAPD patients respectively: group A: < 2 ug/ml (< 11.4 umol/l, deficiency), group B: 2-4 ug/ml (11.4-22.8 umol/l, insufficiency) and group C: > 4 ug/ml (> 22.8 umol/l, normal and above). RESULTS: Patients showed a widely distribution of plasma vitamin C levels in the total 284 dialysis patients. Vitamin C deficiency (< 2 ug/ml) was present in 95(33.45%) and insufficiency (2-4 ug/ml) in 88(30.99%). 73(25.70%) patients had plasma vitamin C levels within normal range (4-14 ug/ml) and 28(9.86%) at higher than normal levels (> 14 ug/ml). The similar proportion of different vitamin C levels was found in both MHD and CAPD groups. Plasma vitamin C level was inversely associated with hsCRP concentration (Spearman r = -0.201, P = 0.001) and positively associated with prealbumin (Spearman r = 0.268, P < 0.001), albumin levels (Spearman r = 0.161, P = 0.007). In multiple linear regression analysis, plasma vitamin C level was inversely associated with log(10)hsCRP (P = 0.048) and positively with prealbumin levels (P = 0.002) adjusted for gender, age, diabetes, modality of dialysis and some other confounding effects. CONCLUSIONS: The investigation indicates that vitamin C deficiency is common in both MHD patients and CAPD patients. Plasma vitamin C level is positively associated with serum prealbumin level and negatively associated with hsCRP level in both groups. Vitamin C deficiency may play an important role in the increased inflammatory status in dialysis patients. Further studies are needed to determine whether inflammatory status in dialysis patients can be improved by using vitamin C supplements. BioMed Central 2011-05-06 /pmc/articles/PMC3112084/ /pubmed/21548917 http://dx.doi.org/10.1186/1471-2369-12-18 Text en Copyright ©2011 Zhang et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Zhang, Kunying
Liu, Li
Cheng, Xuyang
Dong, Jie
Geng, Qiuming
Zuo, Li
Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title_full Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title_fullStr Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title_full_unstemmed Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title_short Low levels of vitamin C in dialysis patients is associated with decreased prealbumin and increased C-reactive protein
title_sort low levels of vitamin c in dialysis patients is associated with decreased prealbumin and increased c-reactive protein
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3112084/
https://www.ncbi.nlm.nih.gov/pubmed/21548917
http://dx.doi.org/10.1186/1471-2369-12-18
work_keys_str_mv AT zhangkunying lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein
AT liuli lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein
AT chengxuyang lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein
AT dongjie lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein
AT gengqiuming lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein
AT zuoli lowlevelsofvitamincindialysispatientsisassociatedwithdecreasedprealbuminandincreasedcreactiveprotein