Cargando…
Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations
Dysferlin is a 237-kDa transmembrane protein involved in calcium-mediated sarcolemma resealing. Dysferlin gene mutations cause limb-girdle muscular dystrophy (LGMD) 2B, Miyoshi myopathy (MM) and distal myopathy of the anterior tibialis. Considering that a secondary Dysferlin reduction has also been...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3179367/ https://www.ncbi.nlm.nih.gov/pubmed/21522182 http://dx.doi.org/10.1038/ejhg.2011.70 |
_version_ | 1782212511527862272 |
---|---|
author | Cacciottolo, Mafalda Numitone, Gelsomina Aurino, Stefania Caserta, Imma Rosaria Fanin, Marina Politano, Luisa Minetti, Carlo Ricci, Enzo Piluso, Giulio Angelini, Corrado Nigro, Vincenzo |
author_facet | Cacciottolo, Mafalda Numitone, Gelsomina Aurino, Stefania Caserta, Imma Rosaria Fanin, Marina Politano, Luisa Minetti, Carlo Ricci, Enzo Piluso, Giulio Angelini, Corrado Nigro, Vincenzo |
author_sort | Cacciottolo, Mafalda |
collection | PubMed |
description | Dysferlin is a 237-kDa transmembrane protein involved in calcium-mediated sarcolemma resealing. Dysferlin gene mutations cause limb-girdle muscular dystrophy (LGMD) 2B, Miyoshi myopathy (MM) and distal myopathy of the anterior tibialis. Considering that a secondary Dysferlin reduction has also been described in other myopathies, our original goal was to identify cases with a Dysferlin deficiency without dysferlin gene mutations. The dysferlin gene is huge, composed of 55 exons that span 233 140 bp of genomic DNA. We performed a thorough mutation analysis in 65 LGMD/MM patients with ≤20% Dysferlin. The screening was exhaustive, as we sequenced both genomic DNA and cDNA. When required, we used other methods, including real-time PCR, long PCR and array CGH. In all patients, we were able to recognize the primary involvement of the dysferlin gene. We identified 38 novel mutation types. Some of these, such as a dysferlin gene duplication, could have been missed by conventional screening strategies. Nonsense-mediated mRNA decay was evident in six cases, in three of which both alleles were only detectable in the genomic DNA but not in the mRNA. Among a wide spectrum of novel gene defects, we found the first example of a ‘nonstop' mutation causing a dysferlinopathy. This study presents the first direct and conclusive evidence that an amount of Dysferlin ≤20% is pathogenic and always caused by primary dysferlin gene mutations. This demonstrates the high specificity of a marked reduction of Dysferlin on western blot and the value of a comprehensive molecular approach for LGMD2B/MM diagnosis. |
format | Online Article Text |
id | pubmed-3179367 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-31793672011-10-20 Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations Cacciottolo, Mafalda Numitone, Gelsomina Aurino, Stefania Caserta, Imma Rosaria Fanin, Marina Politano, Luisa Minetti, Carlo Ricci, Enzo Piluso, Giulio Angelini, Corrado Nigro, Vincenzo Eur J Hum Genet Article Dysferlin is a 237-kDa transmembrane protein involved in calcium-mediated sarcolemma resealing. Dysferlin gene mutations cause limb-girdle muscular dystrophy (LGMD) 2B, Miyoshi myopathy (MM) and distal myopathy of the anterior tibialis. Considering that a secondary Dysferlin reduction has also been described in other myopathies, our original goal was to identify cases with a Dysferlin deficiency without dysferlin gene mutations. The dysferlin gene is huge, composed of 55 exons that span 233 140 bp of genomic DNA. We performed a thorough mutation analysis in 65 LGMD/MM patients with ≤20% Dysferlin. The screening was exhaustive, as we sequenced both genomic DNA and cDNA. When required, we used other methods, including real-time PCR, long PCR and array CGH. In all patients, we were able to recognize the primary involvement of the dysferlin gene. We identified 38 novel mutation types. Some of these, such as a dysferlin gene duplication, could have been missed by conventional screening strategies. Nonsense-mediated mRNA decay was evident in six cases, in three of which both alleles were only detectable in the genomic DNA but not in the mRNA. Among a wide spectrum of novel gene defects, we found the first example of a ‘nonstop' mutation causing a dysferlinopathy. This study presents the first direct and conclusive evidence that an amount of Dysferlin ≤20% is pathogenic and always caused by primary dysferlin gene mutations. This demonstrates the high specificity of a marked reduction of Dysferlin on western blot and the value of a comprehensive molecular approach for LGMD2B/MM diagnosis. Nature Publishing Group 2011-09 2011-04-27 /pmc/articles/PMC3179367/ /pubmed/21522182 http://dx.doi.org/10.1038/ejhg.2011.70 Text en Copyright © 2011 Macmillan Publishers Limited http://creativecommons.org/licenses/by-nc-sa/3.0/ This work is licensed under the Creative Commons Attribution-NonCommercial-Share Alike 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-sa/3.0/ |
spellingShingle | Article Cacciottolo, Mafalda Numitone, Gelsomina Aurino, Stefania Caserta, Imma Rosaria Fanin, Marina Politano, Luisa Minetti, Carlo Ricci, Enzo Piluso, Giulio Angelini, Corrado Nigro, Vincenzo Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title | Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title_full | Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title_fullStr | Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title_full_unstemmed | Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title_short | Muscular dystrophy with marked Dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
title_sort | muscular dystrophy with marked dysferlin deficiency is consistently caused by primary dysferlin gene mutations |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3179367/ https://www.ncbi.nlm.nih.gov/pubmed/21522182 http://dx.doi.org/10.1038/ejhg.2011.70 |
work_keys_str_mv | AT cacciottolomafalda musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT numitonegelsomina musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT aurinostefania musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT casertaimmarosaria musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT faninmarina musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT politanoluisa musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT minetticarlo musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT riccienzo musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT pilusogiulio musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT angelinicorrado musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations AT nigrovincenzo musculardystrophywithmarkeddysferlindeficiencyisconsistentlycausedbyprimarydysferlingenemutations |