Cargando…
Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung
BACKGROUND: Different therapy regimens in non-small-cell lung cancer (NSCLC) are of rising clinical importance, and therefore a clear-cut subdifferentiation is mandatory. The common immunohistochemical markers available today are well applicable for subdifferentiation, but a fraction of indistinct c...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2011
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3188931/ https://www.ncbi.nlm.nih.gov/pubmed/21811254 http://dx.doi.org/10.1038/bjc.2011.281 |
_version_ | 1782213420779569152 |
---|---|
author | Schultz, H Marwitz, S Baron-Lühr, B Zissel, G Kugler, C Rabe, K F Zabel, P Vollmer, E Gerdes, J Goldmann, T |
author_facet | Schultz, H Marwitz, S Baron-Lühr, B Zissel, G Kugler, C Rabe, K F Zabel, P Vollmer, E Gerdes, J Goldmann, T |
author_sort | Schultz, H |
collection | PubMed |
description | BACKGROUND: Different therapy regimens in non-small-cell lung cancer (NSCLC) are of rising clinical importance, and therefore a clear-cut subdifferentiation is mandatory. The common immunohistochemical markers available today are well applicable for subdifferentiation, but a fraction of indistinct cases still remains, demanding upgrades of the panel by new markers. METHODS: We report here the generation and evaluation of a new monoclonal antibody carrying the MAdL designation, which was raised against primary isolated human alveolar epithelial cells type 2. RESULTS: Upon screening, one clone (MAdL) was identified as a marker for alveolar epithelial cell type II, alveolar macrophages and adenocarcinomas of the lung. In a large-scale study, this antibody, with an optimised staining procedure for formalin-fixed tissues, was then evaluated together with the established markers thyroid transcription factor-1, surfactant protein-A, pro-surfactant protein-B and napsin A in a series of 362 lung cancer specimens. The MAdL displays a high specificity (>99%) for adenocarcinomas of the lung, together with a sensitivity of 76.5%, and is capable of delivering independent additional diagnostic information to the established markers. CONCLUSION: We conclude that MAdL is a new specific marker for adenocarcinomas of the lung, which helps to clarify subdifferentiation in a considerable portion of NSCLCs. |
format | Online Article Text |
id | pubmed-3188931 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2011 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-31889312012-08-23 Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung Schultz, H Marwitz, S Baron-Lühr, B Zissel, G Kugler, C Rabe, K F Zabel, P Vollmer, E Gerdes, J Goldmann, T Br J Cancer Molecular Diagnostics BACKGROUND: Different therapy regimens in non-small-cell lung cancer (NSCLC) are of rising clinical importance, and therefore a clear-cut subdifferentiation is mandatory. The common immunohistochemical markers available today are well applicable for subdifferentiation, but a fraction of indistinct cases still remains, demanding upgrades of the panel by new markers. METHODS: We report here the generation and evaluation of a new monoclonal antibody carrying the MAdL designation, which was raised against primary isolated human alveolar epithelial cells type 2. RESULTS: Upon screening, one clone (MAdL) was identified as a marker for alveolar epithelial cell type II, alveolar macrophages and adenocarcinomas of the lung. In a large-scale study, this antibody, with an optimised staining procedure for formalin-fixed tissues, was then evaluated together with the established markers thyroid transcription factor-1, surfactant protein-A, pro-surfactant protein-B and napsin A in a series of 362 lung cancer specimens. The MAdL displays a high specificity (>99%) for adenocarcinomas of the lung, together with a sensitivity of 76.5%, and is capable of delivering independent additional diagnostic information to the established markers. CONCLUSION: We conclude that MAdL is a new specific marker for adenocarcinomas of the lung, which helps to clarify subdifferentiation in a considerable portion of NSCLCs. Nature Publishing Group 2011-08-23 2011-08-02 /pmc/articles/PMC3188931/ /pubmed/21811254 http://dx.doi.org/10.1038/bjc.2011.281 Text en Copyright © 2011 Cancer Research UK https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Molecular Diagnostics Schultz, H Marwitz, S Baron-Lühr, B Zissel, G Kugler, C Rabe, K F Zabel, P Vollmer, E Gerdes, J Goldmann, T Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title | Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title_full | Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title_fullStr | Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title_full_unstemmed | Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title_short | Generation and evaluation of a monoclonal antibody, designated MAdL, as a new specific marker for adenocarcinomas of the lung |
title_sort | generation and evaluation of a monoclonal antibody, designated madl, as a new specific marker for adenocarcinomas of the lung |
topic | Molecular Diagnostics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3188931/ https://www.ncbi.nlm.nih.gov/pubmed/21811254 http://dx.doi.org/10.1038/bjc.2011.281 |
work_keys_str_mv | AT schultzh generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT marwitzs generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT baronluhrb generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT zisselg generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT kuglerc generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT rabekf generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT zabelp generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT vollmere generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT gerdesj generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung AT goldmannt generationandevaluationofamonoclonalantibodydesignatedmadlasanewspecificmarkerforadenocarcinomasofthelung |