Cargando…

Identification of Anaplasma marginale Type IV Secretion System Effector Proteins

BACKGROUND: Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS). The T4SS...

Descripción completa

Detalles Bibliográficos
Autores principales: Lockwood, Svetlana, Voth, Daniel E., Brayton, Kelly A., Beare, Paul A., Brown, Wendy C., Heinzen, Robert A., Broschat, Shira L.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2011
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3225360/
https://www.ncbi.nlm.nih.gov/pubmed/22140462
http://dx.doi.org/10.1371/journal.pone.0027724
_version_ 1782217503580094464
author Lockwood, Svetlana
Voth, Daniel E.
Brayton, Kelly A.
Beare, Paul A.
Brown, Wendy C.
Heinzen, Robert A.
Broschat, Shira L.
author_facet Lockwood, Svetlana
Voth, Daniel E.
Brayton, Kelly A.
Beare, Paul A.
Brown, Wendy C.
Heinzen, Robert A.
Broschat, Shira L.
author_sort Lockwood, Svetlana
collection PubMed
description BACKGROUND: Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS). The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now. RESULTS: By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141) of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system. CONCLUSIONS: The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work.
format Online
Article
Text
id pubmed-3225360
institution National Center for Biotechnology Information
language English
publishDate 2011
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-32253602011-12-02 Identification of Anaplasma marginale Type IV Secretion System Effector Proteins Lockwood, Svetlana Voth, Daniel E. Brayton, Kelly A. Beare, Paul A. Brown, Wendy C. Heinzen, Robert A. Broschat, Shira L. PLoS One Research Article BACKGROUND: Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS). The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now. RESULTS: By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141) of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system. CONCLUSIONS: The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work. Public Library of Science 2011-11-28 /pmc/articles/PMC3225360/ /pubmed/22140462 http://dx.doi.org/10.1371/journal.pone.0027724 Text en This is an open-access article, free of all copyright, and may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. The work is made available under the Creative Commons CC0 public domain dedication. https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose.
spellingShingle Research Article
Lockwood, Svetlana
Voth, Daniel E.
Brayton, Kelly A.
Beare, Paul A.
Brown, Wendy C.
Heinzen, Robert A.
Broschat, Shira L.
Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title_full Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title_fullStr Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title_full_unstemmed Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title_short Identification of Anaplasma marginale Type IV Secretion System Effector Proteins
title_sort identification of anaplasma marginale type iv secretion system effector proteins
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3225360/
https://www.ncbi.nlm.nih.gov/pubmed/22140462
http://dx.doi.org/10.1371/journal.pone.0027724
work_keys_str_mv AT lockwoodsvetlana identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT vothdaniele identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT braytonkellya identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT bearepaula identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT brownwendyc identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT heinzenroberta identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins
AT broschatshiral identificationofanaplasmamarginaletypeivsecretionsystemeffectorproteins