Cargando…
Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tu...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3251853/ https://www.ncbi.nlm.nih.gov/pubmed/22108518 http://dx.doi.org/10.1038/bjc.2011.504 |
_version_ | 1782220569658261504 |
---|---|
author | Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P |
author_facet | Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P |
author_sort | Zeestraten, E C M |
collection | PubMed |
description | BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tumour recurrence in colon cancer. METHODS: In all, 254 patients with completely resected (R0) UICC stage II colon cancer were analysed retrospectively from two independent cohorts from Munich (Germany) and Leiden (Netherlands). None of the patients received adjuvant treatment. Development of distant metastasis was observed in 27 patients (median follow-up: 86 months). Protein expression and activity of CDKs were measured on fresh-frozen tumour samples. RESULTS: Specific activity (SA) of CDK1 (CDK1SA), but not CDK2, significantly predicted distant metastasis (concordance index=0.69, 95% confidence interval (CI): 0.55–0.79, P=0.036). Cutoff derivation by maximum log-rank statistics yielded a threshold of CDK1SA at 11 (SA units, P=0.029). Accordingly, 59% of patients were classified as high-risk (CDK1SA ⩾11). Cox proportional hazard analysis revealed CDK1SA as independent prognostic variable (hazard ratio=6.2, 95% CI: 1.44–26.9, P=0.012). Moreover, CKD1SA was significantly elevated in microsatellite-stable tumours. CONCLUSION: Specific activity of CDK1 is a promising biomarker for metastasis risk in stage II colon cancer. |
format | Online Article Text |
id | pubmed-3251853 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-32518532013-01-03 Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P Br J Cancer Molecular Diagnostics BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tumour recurrence in colon cancer. METHODS: In all, 254 patients with completely resected (R0) UICC stage II colon cancer were analysed retrospectively from two independent cohorts from Munich (Germany) and Leiden (Netherlands). None of the patients received adjuvant treatment. Development of distant metastasis was observed in 27 patients (median follow-up: 86 months). Protein expression and activity of CDKs were measured on fresh-frozen tumour samples. RESULTS: Specific activity (SA) of CDK1 (CDK1SA), but not CDK2, significantly predicted distant metastasis (concordance index=0.69, 95% confidence interval (CI): 0.55–0.79, P=0.036). Cutoff derivation by maximum log-rank statistics yielded a threshold of CDK1SA at 11 (SA units, P=0.029). Accordingly, 59% of patients were classified as high-risk (CDK1SA ⩾11). Cox proportional hazard analysis revealed CDK1SA as independent prognostic variable (hazard ratio=6.2, 95% CI: 1.44–26.9, P=0.012). Moreover, CKD1SA was significantly elevated in microsatellite-stable tumours. CONCLUSION: Specific activity of CDK1 is a promising biomarker for metastasis risk in stage II colon cancer. Nature Publishing Group 2012-01-03 2011-11-22 /pmc/articles/PMC3251853/ /pubmed/22108518 http://dx.doi.org/10.1038/bjc.2011.504 Text en Copyright © 2012 Cancer Research UK https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Molecular Diagnostics Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title_full | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title_fullStr | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title_full_unstemmed | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title_short | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
title_sort | specific activity of cyclin-dependent kinase i is a new potential predictor of tumour recurrence in stage ii colon cancer |
topic | Molecular Diagnostics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3251853/ https://www.ncbi.nlm.nih.gov/pubmed/22108518 http://dx.doi.org/10.1038/bjc.2011.504 |
work_keys_str_mv | AT zeestratenecm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT maakm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT shibayamam specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT schustert specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT nitscheu specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT matsushimat specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT nakayamas specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT gohdak specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT friessh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT vandeveldecjh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT ishiharah specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT rosenbergr specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT kuppenpjk specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT janssenkp specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer |