Cargando…

Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer

BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tu...

Descripción completa

Detalles Bibliográficos
Autores principales: Zeestraten, E C M, Maak, M, Shibayama, M, Schuster, T, Nitsche, U, Matsushima, T, Nakayama, S, Gohda, K, Friess, H, van de Velde, C J H, Ishihara, H, Rosenberg, R, Kuppen, P J K, Janssen, K-P
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3251853/
https://www.ncbi.nlm.nih.gov/pubmed/22108518
http://dx.doi.org/10.1038/bjc.2011.504
_version_ 1782220569658261504
author Zeestraten, E C M
Maak, M
Shibayama, M
Schuster, T
Nitsche, U
Matsushima, T
Nakayama, S
Gohda, K
Friess, H
van de Velde, C J H
Ishihara, H
Rosenberg, R
Kuppen, P J K
Janssen, K-P
author_facet Zeestraten, E C M
Maak, M
Shibayama, M
Schuster, T
Nitsche, U
Matsushima, T
Nakayama, S
Gohda, K
Friess, H
van de Velde, C J H
Ishihara, H
Rosenberg, R
Kuppen, P J K
Janssen, K-P
author_sort Zeestraten, E C M
collection PubMed
description BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tumour recurrence in colon cancer. METHODS: In all, 254 patients with completely resected (R0) UICC stage II colon cancer were analysed retrospectively from two independent cohorts from Munich (Germany) and Leiden (Netherlands). None of the patients received adjuvant treatment. Development of distant metastasis was observed in 27 patients (median follow-up: 86 months). Protein expression and activity of CDKs were measured on fresh-frozen tumour samples. RESULTS: Specific activity (SA) of CDK1 (CDK1SA), but not CDK2, significantly predicted distant metastasis (concordance index=0.69, 95% confidence interval (CI): 0.55–0.79, P=0.036). Cutoff derivation by maximum log-rank statistics yielded a threshold of CDK1SA at 11 (SA units, P=0.029). Accordingly, 59% of patients were classified as high-risk (CDK1SA ⩾11). Cox proportional hazard analysis revealed CDK1SA as independent prognostic variable (hazard ratio=6.2, 95% CI: 1.44–26.9, P=0.012). Moreover, CKD1SA was significantly elevated in microsatellite-stable tumours. CONCLUSION: Specific activity of CDK1 is a promising biomarker for metastasis risk in stage II colon cancer.
format Online
Article
Text
id pubmed-3251853
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-32518532013-01-03 Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P Br J Cancer Molecular Diagnostics BACKGROUND: There are no established biomarkers to identify tumour recurrence in stage II colon cancer. As shown previously, the enzymatic activity of the cyclin-dependent kinases 1 and 2 (CDK1 and CDK2) predicts outcome in breast cancer. Therefore, we investigated whether CDK activity identifies tumour recurrence in colon cancer. METHODS: In all, 254 patients with completely resected (R0) UICC stage II colon cancer were analysed retrospectively from two independent cohorts from Munich (Germany) and Leiden (Netherlands). None of the patients received adjuvant treatment. Development of distant metastasis was observed in 27 patients (median follow-up: 86 months). Protein expression and activity of CDKs were measured on fresh-frozen tumour samples. RESULTS: Specific activity (SA) of CDK1 (CDK1SA), but not CDK2, significantly predicted distant metastasis (concordance index=0.69, 95% confidence interval (CI): 0.55–0.79, P=0.036). Cutoff derivation by maximum log-rank statistics yielded a threshold of CDK1SA at 11 (SA units, P=0.029). Accordingly, 59% of patients were classified as high-risk (CDK1SA ⩾11). Cox proportional hazard analysis revealed CDK1SA as independent prognostic variable (hazard ratio=6.2, 95% CI: 1.44–26.9, P=0.012). Moreover, CKD1SA was significantly elevated in microsatellite-stable tumours. CONCLUSION: Specific activity of CDK1 is a promising biomarker for metastasis risk in stage II colon cancer. Nature Publishing Group 2012-01-03 2011-11-22 /pmc/articles/PMC3251853/ /pubmed/22108518 http://dx.doi.org/10.1038/bjc.2011.504 Text en Copyright © 2012 Cancer Research UK https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/.
spellingShingle Molecular Diagnostics
Zeestraten, E C M
Maak, M
Shibayama, M
Schuster, T
Nitsche, U
Matsushima, T
Nakayama, S
Gohda, K
Friess, H
van de Velde, C J H
Ishihara, H
Rosenberg, R
Kuppen, P J K
Janssen, K-P
Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title_full Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title_fullStr Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title_full_unstemmed Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title_short Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
title_sort specific activity of cyclin-dependent kinase i is a new potential predictor of tumour recurrence in stage ii colon cancer
topic Molecular Diagnostics
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3251853/
https://www.ncbi.nlm.nih.gov/pubmed/22108518
http://dx.doi.org/10.1038/bjc.2011.504
work_keys_str_mv AT zeestratenecm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT maakm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT shibayamam specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT schustert specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT nitscheu specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT matsushimat specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT nakayamas specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT gohdak specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT friessh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT vandeveldecjh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT ishiharah specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT rosenbergr specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT kuppenpjk specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer
AT janssenkp specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer