Cargando…

S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis

BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with...

Descripción completa

Detalles Bibliográficos
Autores principales: Reinhard, Lisa, Rupp, Christian, Riedel, Hans-Dieter, Ruppert, Thomas, Giese, Thomas, Flechtenmacher, Christa, Weiss, Karl Heinz, Kloeters-Plachky, Petra, Stremmel, Wolfgang, Schirmacher, Peter, Sauer, Peter, Gotthardt, Daniel Nils
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3256182/
https://www.ncbi.nlm.nih.gov/pubmed/22253789
http://dx.doi.org/10.1371/journal.pone.0029821
_version_ 1782221049634488320
author Reinhard, Lisa
Rupp, Christian
Riedel, Hans-Dieter
Ruppert, Thomas
Giese, Thomas
Flechtenmacher, Christa
Weiss, Karl Heinz
Kloeters-Plachky, Petra
Stremmel, Wolfgang
Schirmacher, Peter
Sauer, Peter
Gotthardt, Daniel Nils
author_facet Reinhard, Lisa
Rupp, Christian
Riedel, Hans-Dieter
Ruppert, Thomas
Giese, Thomas
Flechtenmacher, Christa
Weiss, Karl Heinz
Kloeters-Plachky, Petra
Stremmel, Wolfgang
Schirmacher, Peter
Sauer, Peter
Gotthardt, Daniel Nils
author_sort Reinhard, Lisa
collection PubMed
description BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach. METHODS: Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR. RESULTS: A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05). CONCLUSIONS: The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation.
format Online
Article
Text
id pubmed-3256182
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-32561822012-01-17 S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis Reinhard, Lisa Rupp, Christian Riedel, Hans-Dieter Ruppert, Thomas Giese, Thomas Flechtenmacher, Christa Weiss, Karl Heinz Kloeters-Plachky, Petra Stremmel, Wolfgang Schirmacher, Peter Sauer, Peter Gotthardt, Daniel Nils PLoS One Research Article BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach. METHODS: Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR. RESULTS: A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05). CONCLUSIONS: The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation. Public Library of Science 2012-01-11 /pmc/articles/PMC3256182/ /pubmed/22253789 http://dx.doi.org/10.1371/journal.pone.0029821 Text en Reinhard et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Reinhard, Lisa
Rupp, Christian
Riedel, Hans-Dieter
Ruppert, Thomas
Giese, Thomas
Flechtenmacher, Christa
Weiss, Karl Heinz
Kloeters-Plachky, Petra
Stremmel, Wolfgang
Schirmacher, Peter
Sauer, Peter
Gotthardt, Daniel Nils
S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title_full S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title_fullStr S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title_full_unstemmed S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title_short S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
title_sort s100a9 is a biliary protein marker of disease activity in primary sclerosing cholangitis
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3256182/
https://www.ncbi.nlm.nih.gov/pubmed/22253789
http://dx.doi.org/10.1371/journal.pone.0029821
work_keys_str_mv AT reinhardlisa s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT ruppchristian s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT riedelhansdieter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT ruppertthomas s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT giesethomas s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT flechtenmacherchrista s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT weisskarlheinz s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT kloetersplachkypetra s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT stremmelwolfgang s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT schirmacherpeter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT sauerpeter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
AT gotthardtdanielnils s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis