Cargando…
S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis
BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3256182/ https://www.ncbi.nlm.nih.gov/pubmed/22253789 http://dx.doi.org/10.1371/journal.pone.0029821 |
_version_ | 1782221049634488320 |
---|---|
author | Reinhard, Lisa Rupp, Christian Riedel, Hans-Dieter Ruppert, Thomas Giese, Thomas Flechtenmacher, Christa Weiss, Karl Heinz Kloeters-Plachky, Petra Stremmel, Wolfgang Schirmacher, Peter Sauer, Peter Gotthardt, Daniel Nils |
author_facet | Reinhard, Lisa Rupp, Christian Riedel, Hans-Dieter Ruppert, Thomas Giese, Thomas Flechtenmacher, Christa Weiss, Karl Heinz Kloeters-Plachky, Petra Stremmel, Wolfgang Schirmacher, Peter Sauer, Peter Gotthardt, Daniel Nils |
author_sort | Reinhard, Lisa |
collection | PubMed |
description | BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach. METHODS: Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR. RESULTS: A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05). CONCLUSIONS: The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation. |
format | Online Article Text |
id | pubmed-3256182 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-32561822012-01-17 S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis Reinhard, Lisa Rupp, Christian Riedel, Hans-Dieter Ruppert, Thomas Giese, Thomas Flechtenmacher, Christa Weiss, Karl Heinz Kloeters-Plachky, Petra Stremmel, Wolfgang Schirmacher, Peter Sauer, Peter Gotthardt, Daniel Nils PLoS One Research Article BACKGROUND AND AIMS: Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach. METHODS: Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR. RESULTS: A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05). CONCLUSIONS: The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation. Public Library of Science 2012-01-11 /pmc/articles/PMC3256182/ /pubmed/22253789 http://dx.doi.org/10.1371/journal.pone.0029821 Text en Reinhard et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Reinhard, Lisa Rupp, Christian Riedel, Hans-Dieter Ruppert, Thomas Giese, Thomas Flechtenmacher, Christa Weiss, Karl Heinz Kloeters-Plachky, Petra Stremmel, Wolfgang Schirmacher, Peter Sauer, Peter Gotthardt, Daniel Nils S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title | S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title_full | S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title_fullStr | S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title_full_unstemmed | S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title_short | S100A9 is a Biliary Protein Marker of Disease Activity in Primary Sclerosing Cholangitis |
title_sort | s100a9 is a biliary protein marker of disease activity in primary sclerosing cholangitis |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3256182/ https://www.ncbi.nlm.nih.gov/pubmed/22253789 http://dx.doi.org/10.1371/journal.pone.0029821 |
work_keys_str_mv | AT reinhardlisa s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT ruppchristian s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT riedelhansdieter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT ruppertthomas s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT giesethomas s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT flechtenmacherchrista s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT weisskarlheinz s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT kloetersplachkypetra s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT stremmelwolfgang s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT schirmacherpeter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT sauerpeter s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT gotthardtdanielnils s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis |