Cargando…

Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium

Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress...

Descripción completa

Detalles Bibliográficos
Autores principales: Ognjanović, Branka I., Djordjević, Nataša Z., Matić, Miloš M., Obradović, Jasmina M., Mladenović, Jelena M., Štajn, Andraš Š., Saičić, Zorica S.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Molecular Diversity Preservation International (MDPI) 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3291993/
https://www.ncbi.nlm.nih.gov/pubmed/22408424
http://dx.doi.org/10.3390/ijms13021790
_version_ 1782225212784246784
author Ognjanović, Branka I.
Djordjević, Nataša Z.
Matić, Miloš M.
Obradović, Jasmina M.
Mladenović, Jelena M.
Štajn, Andraš Š.
Saičić, Zorica S.
author_facet Ognjanović, Branka I.
Djordjević, Nataša Z.
Matić, Miloš M.
Obradović, Jasmina M.
Mladenović, Jelena M.
Štajn, Andraš Š.
Saičić, Zorica S.
author_sort Ognjanović, Branka I.
collection PubMed
description Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress in the rat kidneys. Male Wistar albino rats were injected with a single dose of cisplatin (7 mg CP/kg b.m., i.p.) and selenium (6 mg Se/kg b.m, as Na(2)SeO(3), i.p.), alone or in combination. The obtained results showed that CP increased lipid peroxidation (LPO) and decreased reduced glutathione (GSH) concentrations, suggesting the CP-induced oxidative stress, while Se treatment reversed this change to control values. Acute intoxication of rats with CP was followed by statistically significant decreased activity of antioxidant defense enzymes: superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR) and glutathione-S-transferase (GST). Treatment with Se reversed CP-induced alterations of antioxidant defense enzyme activities and significantly prevented the CP-induced kidney damage.
format Online
Article
Text
id pubmed-3291993
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Molecular Diversity Preservation International (MDPI)
record_format MEDLINE/PubMed
spelling pubmed-32919932012-03-09 Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium Ognjanović, Branka I. Djordjević, Nataša Z. Matić, Miloš M. Obradović, Jasmina M. Mladenović, Jelena M. Štajn, Andraš Š. Saičić, Zorica S. Int J Mol Sci Article Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress in the rat kidneys. Male Wistar albino rats were injected with a single dose of cisplatin (7 mg CP/kg b.m., i.p.) and selenium (6 mg Se/kg b.m, as Na(2)SeO(3), i.p.), alone or in combination. The obtained results showed that CP increased lipid peroxidation (LPO) and decreased reduced glutathione (GSH) concentrations, suggesting the CP-induced oxidative stress, while Se treatment reversed this change to control values. Acute intoxication of rats with CP was followed by statistically significant decreased activity of antioxidant defense enzymes: superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR) and glutathione-S-transferase (GST). Treatment with Se reversed CP-induced alterations of antioxidant defense enzyme activities and significantly prevented the CP-induced kidney damage. Molecular Diversity Preservation International (MDPI) 2012-02-08 /pmc/articles/PMC3291993/ /pubmed/22408424 http://dx.doi.org/10.3390/ijms13021790 Text en © 2012 by the authors; licensee Molecular Diversity Preservation International, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0 This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
spellingShingle Article
Ognjanović, Branka I.
Djordjević, Nataša Z.
Matić, Miloš M.
Obradović, Jasmina M.
Mladenović, Jelena M.
Štajn, Andraš Š.
Saičić, Zorica S.
Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title_full Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title_fullStr Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title_full_unstemmed Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title_short Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
title_sort lipid peroxidative damage on cisplatin exposure and alterations in antioxidant defense system in rat kidneys: a possible protective effect of selenium
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3291993/
https://www.ncbi.nlm.nih.gov/pubmed/22408424
http://dx.doi.org/10.3390/ijms13021790
work_keys_str_mv AT ognjanovicbrankai lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT djordjevicnatasaz lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT maticmilosm lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT obradovicjasminam lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT mladenovicjelenam lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT stajnandrass lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium
AT saiciczoricas lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium