Cargando…
Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium
Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Molecular Diversity Preservation International (MDPI)
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3291993/ https://www.ncbi.nlm.nih.gov/pubmed/22408424 http://dx.doi.org/10.3390/ijms13021790 |
_version_ | 1782225212784246784 |
---|---|
author | Ognjanović, Branka I. Djordjević, Nataša Z. Matić, Miloš M. Obradović, Jasmina M. Mladenović, Jelena M. Štajn, Andraš Š. Saičić, Zorica S. |
author_facet | Ognjanović, Branka I. Djordjević, Nataša Z. Matić, Miloš M. Obradović, Jasmina M. Mladenović, Jelena M. Štajn, Andraš Š. Saičić, Zorica S. |
author_sort | Ognjanović, Branka I. |
collection | PubMed |
description | Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress in the rat kidneys. Male Wistar albino rats were injected with a single dose of cisplatin (7 mg CP/kg b.m., i.p.) and selenium (6 mg Se/kg b.m, as Na(2)SeO(3), i.p.), alone or in combination. The obtained results showed that CP increased lipid peroxidation (LPO) and decreased reduced glutathione (GSH) concentrations, suggesting the CP-induced oxidative stress, while Se treatment reversed this change to control values. Acute intoxication of rats with CP was followed by statistically significant decreased activity of antioxidant defense enzymes: superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR) and glutathione-S-transferase (GST). Treatment with Se reversed CP-induced alterations of antioxidant defense enzyme activities and significantly prevented the CP-induced kidney damage. |
format | Online Article Text |
id | pubmed-3291993 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Molecular Diversity Preservation International (MDPI) |
record_format | MEDLINE/PubMed |
spelling | pubmed-32919932012-03-09 Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium Ognjanović, Branka I. Djordjević, Nataša Z. Matić, Miloš M. Obradović, Jasmina M. Mladenović, Jelena M. Štajn, Andraš Š. Saičić, Zorica S. Int J Mol Sci Article Cisplatin (Cis-diamminedichloroplatinum II, CP) is an important chemotherapeutic agent, useful in the treatment of several cancers, but with several side effects such as nephrotoxicity. The present study investigated the possible protective effect of selenium (Se) against CP-induced oxidative stress in the rat kidneys. Male Wistar albino rats were injected with a single dose of cisplatin (7 mg CP/kg b.m., i.p.) and selenium (6 mg Se/kg b.m, as Na(2)SeO(3), i.p.), alone or in combination. The obtained results showed that CP increased lipid peroxidation (LPO) and decreased reduced glutathione (GSH) concentrations, suggesting the CP-induced oxidative stress, while Se treatment reversed this change to control values. Acute intoxication of rats with CP was followed by statistically significant decreased activity of antioxidant defense enzymes: superoxide dismutase (SOD), catalase (CAT), glutathione peroxidase (GSH-Px), glutathione reductase (GR) and glutathione-S-transferase (GST). Treatment with Se reversed CP-induced alterations of antioxidant defense enzyme activities and significantly prevented the CP-induced kidney damage. Molecular Diversity Preservation International (MDPI) 2012-02-08 /pmc/articles/PMC3291993/ /pubmed/22408424 http://dx.doi.org/10.3390/ijms13021790 Text en © 2012 by the authors; licensee Molecular Diversity Preservation International, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0 This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Ognjanović, Branka I. Djordjević, Nataša Z. Matić, Miloš M. Obradović, Jasmina M. Mladenović, Jelena M. Štajn, Andraš Š. Saičić, Zorica S. Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title | Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title_full | Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title_fullStr | Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title_full_unstemmed | Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title_short | Lipid Peroxidative Damage on Cisplatin Exposure and Alterations in Antioxidant Defense System in Rat Kidneys: A Possible Protective Effect of Selenium |
title_sort | lipid peroxidative damage on cisplatin exposure and alterations in antioxidant defense system in rat kidneys: a possible protective effect of selenium |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3291993/ https://www.ncbi.nlm.nih.gov/pubmed/22408424 http://dx.doi.org/10.3390/ijms13021790 |
work_keys_str_mv | AT ognjanovicbrankai lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT djordjevicnatasaz lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT maticmilosm lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT obradovicjasminam lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT mladenovicjelenam lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT stajnandrass lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium AT saiciczoricas lipidperoxidativedamageoncisplatinexposureandalterationsinantioxidantdefensesysteminratkidneysapossibleprotectiveeffectofselenium |