Cargando…
Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing
Understanding the evolution of the human immunodeficiency virus type 1 (HIV-1) envelope during disease progression can provide tremendous insights for vaccine development, and simian-human immunodeficiency virus (SHIV) infection of non-human primate provides an ideal platform for such studies. A new...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3299704/ https://www.ncbi.nlm.nih.gov/pubmed/22427893 http://dx.doi.org/10.1371/journal.pone.0032827 |
_version_ | 1782226153298198528 |
---|---|
author | Tso, For Yue Tully, Damien C. Gonzalez, Sandra Quince, Christopher Ho, On Polacino, Patricia Ruprecht, Ruth M. Hu, Shiu-Lok Wood, Charles |
author_facet | Tso, For Yue Tully, Damien C. Gonzalez, Sandra Quince, Christopher Ho, On Polacino, Patricia Ruprecht, Ruth M. Hu, Shiu-Lok Wood, Charles |
author_sort | Tso, For Yue |
collection | PubMed |
description | Understanding the evolution of the human immunodeficiency virus type 1 (HIV-1) envelope during disease progression can provide tremendous insights for vaccine development, and simian-human immunodeficiency virus (SHIV) infection of non-human primate provides an ideal platform for such studies. A newly developed clade C SHIV, SHIV-1157ipd3N4, which was able to infect rhesus macaques, closely resembled primary HIV-1 in transmission and pathogenesis, was used to infect several pig-tailed macaques. One of the infected animals subsequently progressed to AIDS, whereas one remained a non-progressor. The viral envelope evolution in the infected animals during disease progression was analyzed by a bioinformatics approach using ultra-deep pyrosequencing. Our results showed substantial envelope variations emerging in the progressor animal after the onset of AIDS. These envelope variations impacted the length of the variable loops and charges of different envelope regions. Additionally, multiple mutations were located at the CD4 and CCR5 binding sites, potentially affecting receptor binding affinity, viral fitness and they might be selected at late stages of disease. More importantly, these envelope mutations are not random since they had repeatedly been observed in a rhesus macaque and a human infant infected by either SHIV or HIV-1, respectively, carrying the parental envelope of the infectious molecular clone SHIV-1157ipd3N4. Moreover, similar mutations were also observed from other studies on different clades of envelopes regardless of the host species. These recurring mutations in different envelopes suggest that there may be a common evolutionary pattern and selection pathway for the HIV-1 envelope during disease progression. |
format | Online Article Text |
id | pubmed-3299704 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-32997042012-03-16 Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing Tso, For Yue Tully, Damien C. Gonzalez, Sandra Quince, Christopher Ho, On Polacino, Patricia Ruprecht, Ruth M. Hu, Shiu-Lok Wood, Charles PLoS One Research Article Understanding the evolution of the human immunodeficiency virus type 1 (HIV-1) envelope during disease progression can provide tremendous insights for vaccine development, and simian-human immunodeficiency virus (SHIV) infection of non-human primate provides an ideal platform for such studies. A newly developed clade C SHIV, SHIV-1157ipd3N4, which was able to infect rhesus macaques, closely resembled primary HIV-1 in transmission and pathogenesis, was used to infect several pig-tailed macaques. One of the infected animals subsequently progressed to AIDS, whereas one remained a non-progressor. The viral envelope evolution in the infected animals during disease progression was analyzed by a bioinformatics approach using ultra-deep pyrosequencing. Our results showed substantial envelope variations emerging in the progressor animal after the onset of AIDS. These envelope variations impacted the length of the variable loops and charges of different envelope regions. Additionally, multiple mutations were located at the CD4 and CCR5 binding sites, potentially affecting receptor binding affinity, viral fitness and they might be selected at late stages of disease. More importantly, these envelope mutations are not random since they had repeatedly been observed in a rhesus macaque and a human infant infected by either SHIV or HIV-1, respectively, carrying the parental envelope of the infectious molecular clone SHIV-1157ipd3N4. Moreover, similar mutations were also observed from other studies on different clades of envelopes regardless of the host species. These recurring mutations in different envelopes suggest that there may be a common evolutionary pattern and selection pathway for the HIV-1 envelope during disease progression. Public Library of Science 2012-03-12 /pmc/articles/PMC3299704/ /pubmed/22427893 http://dx.doi.org/10.1371/journal.pone.0032827 Text en Tso et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Tso, For Yue Tully, Damien C. Gonzalez, Sandra Quince, Christopher Ho, On Polacino, Patricia Ruprecht, Ruth M. Hu, Shiu-Lok Wood, Charles Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title | Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title_full | Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title_fullStr | Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title_full_unstemmed | Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title_short | Dynamics of Envelope Evolution in Clade C SHIV-Infected Pig-Tailed Macaques during Disease Progression Analyzed by Ultra-Deep Pyrosequencing |
title_sort | dynamics of envelope evolution in clade c shiv-infected pig-tailed macaques during disease progression analyzed by ultra-deep pyrosequencing |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3299704/ https://www.ncbi.nlm.nih.gov/pubmed/22427893 http://dx.doi.org/10.1371/journal.pone.0032827 |
work_keys_str_mv | AT tsoforyue dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT tullydamienc dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT gonzalezsandra dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT quincechristopher dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT hoon dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT polacinopatricia dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT ruprechtruthm dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT hushiulok dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing AT woodcharles dynamicsofenvelopeevolutionincladecshivinfectedpigtailedmacaquesduringdiseaseprogressionanalyzedbyultradeeppyrosequencing |