On the Existence of Wavelet Symmetries in Archaea DNA

This paper deals with the complex unit roots representation of archea DNA sequences and the analysis of symmetries in the wavelet coefficients of the digitalized sequence. It is shown that even for extremophile archaea, the distribution of nucleotides has to fulfill some (mathematical) constraints i...

Descripción completa

Detalles Bibliográficos
Autor principal: Cattani, Carlo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2012
Materias:
Research Article
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3310297/
https://www.ncbi.nlm.nih.gov/pubmed/22481976
http://dx.doi.org/10.1155/2012/673934
_version_ 1782227636311818240
author Cattani, Carlo
author_facet Cattani, Carlo
author_sort Cattani, Carlo
collection PubMed
description This paper deals with the complex unit roots representation of archea DNA sequences and the analysis of symmetries in the wavelet coefficients of the digitalized sequence. It is shown that even for extremophile archaea, the distribution of nucleotides has to fulfill some (mathematical) constraints in such a way that the wavelet coefficients are symmetrically distributed, with respect to the nucleotides distribution.
format Online
Article
Text
id pubmed-3310297
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-33102972012-04-05 On the Existence of Wavelet Symmetries in Archaea DNA Cattani, Carlo Comput Math Methods Med Research Article This paper deals with the complex unit roots representation of archea DNA sequences and the analysis of symmetries in the wavelet coefficients of the digitalized sequence. It is shown that even for extremophile archaea, the distribution of nucleotides has to fulfill some (mathematical) constraints in such a way that the wavelet coefficients are symmetrically distributed, with respect to the nucleotides distribution. Hindawi Publishing Corporation 2012 2011-11-28 /pmc/articles/PMC3310297/ /pubmed/22481976 http://dx.doi.org/10.1155/2012/673934 Text en Copyright © 2012 Carlo Cattani. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Cattani, Carlo
On the Existence of Wavelet Symmetries in Archaea DNA
title On the Existence of Wavelet Symmetries in Archaea DNA
title_full On the Existence of Wavelet Symmetries in Archaea DNA
title_fullStr On the Existence of Wavelet Symmetries in Archaea DNA
title_full_unstemmed On the Existence of Wavelet Symmetries in Archaea DNA
title_short On the Existence of Wavelet Symmetries in Archaea DNA
title_sort on the existence of wavelet symmetries in archaea dna
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3310297/
https://www.ncbi.nlm.nih.gov/pubmed/22481976
http://dx.doi.org/10.1155/2012/673934
work_keys_str_mv AT cattanicarlo ontheexistenceofwaveletsymmetriesinarchaeadna

Ejemplares similares