Cargando…
Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer
| Autores principales: | , , , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Nature Publishing Group
2012
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3322963/ http://dx.doi.org/10.1038/bjc.2012.38 |
| _version_ | 1782229127851409408 |
|---|---|
| author | Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P |
| author_facet | Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P |
| author_sort | Zeestraten, E C M |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-3322963 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2012 |
| publisher | Nature Publishing Group |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-33229632013-02-14 Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P Br J Cancer Corrigendum Nature Publishing Group 2012-02-14 2012-02-14 /pmc/articles/PMC3322963/ http://dx.doi.org/10.1038/bjc.2012.38 Text en Copyright © 2012 Cancer Research UK https://creativecommons.org/licenses/by/4.0/This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material.If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit https://creativecommons.org/licenses/by/4.0/. |
| spellingShingle | Corrigendum Zeestraten, E C M Maak, M Shibayama, M Schuster, T Nitsche, U Matsushima, T Nakayama, S Gohda, K Friess, H van de Velde, C J H Ishihara, H Rosenberg, R Kuppen, P J K Janssen, K-P Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title_full | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title_fullStr | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title_full_unstemmed | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title_short | Specific activity of cyclin-dependent kinase I is a new potential predictor of tumour recurrence in stage II colon cancer |
| title_sort | specific activity of cyclin-dependent kinase i is a new potential predictor of tumour recurrence in stage ii colon cancer |
| topic | Corrigendum |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3322963/ http://dx.doi.org/10.1038/bjc.2012.38 |
| work_keys_str_mv | AT zeestratenecm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT maakm specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT shibayamam specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT schustert specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT nitscheu specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT matsushimat specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT nakayamas specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT gohdak specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT friessh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT vandeveldecjh specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT ishiharah specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT rosenbergr specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT kuppenpjk specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer AT janssenkp specificactivityofcyclindependentkinaseiisanewpotentialpredictoroftumourrecurrenceinstageiicoloncancer |