12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1

Detalles Bibliográficos
Autores principales: Kuijk, LM, Frenkel, J, Waterham, HR, Koster, J, Coffer, PJ
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2008
Materias:
Oral Presentation
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3334181/
http://dx.doi.org/10.1186/1546-0096-6-S1-S24
_version_ 1782230608102031360
author Kuijk, LM
Frenkel, J
Waterham, HR
Koster, J
Coffer, PJ
author_facet Kuijk, LM
Frenkel, J
Waterham, HR
Koster, J
Coffer, PJ
author_sort Kuijk, LM
collection PubMed
description
format Online
Article
Text
id pubmed-3334181
institution National Center for Biotechnology Information
language English
publishDate 2008
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-33341812012-04-24 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1 Kuijk, LM Frenkel, J Waterham, HR Koster, J Coffer, PJ Pediatr Rheumatol Online J Oral Presentation BioMed Central 2008-09-15 /pmc/articles/PMC3334181/ http://dx.doi.org/10.1186/1546-0096-6-S1-S24 Text en Copyright ©2008 Kuijk et al; licensee BioMed Central Ltd.
spellingShingle Oral Presentation
Kuijk, LM
Frenkel, J
Waterham, HR
Koster, J
Coffer, PJ
12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title_full 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title_fullStr 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title_full_unstemmed 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title_short 12.2 Mevalonate kinase deficiency: Impaired isoprenoid synthesis induces IL-1beta production via activation of Rac1
title_sort 12.2 mevalonate kinase deficiency: impaired isoprenoid synthesis induces il-1beta production via activation of rac1
topic Oral Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3334181/
http://dx.doi.org/10.1186/1546-0096-6-S1-S24
work_keys_str_mv AT kuijklm 122mevalonatekinasedeficiencyimpairedisoprenoidsynthesisinducesil1betaproductionviaactivationofrac1
AT frenkelj 122mevalonatekinasedeficiencyimpairedisoprenoidsynthesisinducesil1betaproductionviaactivationofrac1
AT waterhamhr 122mevalonatekinasedeficiencyimpairedisoprenoidsynthesisinducesil1betaproductionviaactivationofrac1
AT kosterj 122mevalonatekinasedeficiencyimpairedisoprenoidsynthesisinducesil1betaproductionviaactivationofrac1
AT cofferpj 122mevalonatekinasedeficiencyimpairedisoprenoidsynthesisinducesil1betaproductionviaactivationofrac1

Ejemplares similares