Cargando…
Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling
Integrin-linked kinase (ILK) is an important scaffold protein that mediates a variety of cellular responses to integrin stimulation by extracellular matrix proteins. Mice with epidermis-restricted inactivation of the Ilk gene exhibit pleiotropic phenotypic defects, including impaired hair follicle m...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3344928/ https://www.ncbi.nlm.nih.gov/pubmed/22574216 http://dx.doi.org/10.1371/journal.pone.0036704 |
_version_ | 1782232100836999168 |
---|---|
author | Judah, David Rudkouskaya, Alena Wilson, Ryan Carter, David E. Dagnino, Lina |
author_facet | Judah, David Rudkouskaya, Alena Wilson, Ryan Carter, David E. Dagnino, Lina |
author_sort | Judah, David |
collection | PubMed |
description | Integrin-linked kinase (ILK) is an important scaffold protein that mediates a variety of cellular responses to integrin stimulation by extracellular matrix proteins. Mice with epidermis-restricted inactivation of the Ilk gene exhibit pleiotropic phenotypic defects, including impaired hair follicle morphogenesis, reduced epidermal adhesion to the basement membrane, compromised epidermal integrity, as well as wasting and failure to thrive leading to perinatal death. To better understand the underlying molecular mechanisms that cause such a broad range of alterations, we investigated the impact of Ilk gene inactivation on the epidermis transcriptome. Microarray analysis showed over 700 differentially regulated mRNAs encoding proteins involved in multiple aspects of epidermal function, including keratinocyte differentiation and barrier formation, inflammation, regeneration after injury, and fundamental epidermal developmental pathways. These studies also revealed potential effects on genes not previously implicated in ILK functions, including those important for melanocyte and melanoblast development and function, regulation of cytoskeletal dynamics, and homeobox genes. This study shows that ILK is a critical regulator of multiple aspects of epidermal function and homeostasis, and reveals the previously unreported involvement of ILK not only in epidermal differentiation and barrier formation, but also in melanocyte genesis and function. |
format | Online Article Text |
id | pubmed-3344928 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-33449282012-05-09 Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling Judah, David Rudkouskaya, Alena Wilson, Ryan Carter, David E. Dagnino, Lina PLoS One Research Article Integrin-linked kinase (ILK) is an important scaffold protein that mediates a variety of cellular responses to integrin stimulation by extracellular matrix proteins. Mice with epidermis-restricted inactivation of the Ilk gene exhibit pleiotropic phenotypic defects, including impaired hair follicle morphogenesis, reduced epidermal adhesion to the basement membrane, compromised epidermal integrity, as well as wasting and failure to thrive leading to perinatal death. To better understand the underlying molecular mechanisms that cause such a broad range of alterations, we investigated the impact of Ilk gene inactivation on the epidermis transcriptome. Microarray analysis showed over 700 differentially regulated mRNAs encoding proteins involved in multiple aspects of epidermal function, including keratinocyte differentiation and barrier formation, inflammation, regeneration after injury, and fundamental epidermal developmental pathways. These studies also revealed potential effects on genes not previously implicated in ILK functions, including those important for melanocyte and melanoblast development and function, regulation of cytoskeletal dynamics, and homeobox genes. This study shows that ILK is a critical regulator of multiple aspects of epidermal function and homeostasis, and reveals the previously unreported involvement of ILK not only in epidermal differentiation and barrier formation, but also in melanocyte genesis and function. Public Library of Science 2012-05-04 /pmc/articles/PMC3344928/ /pubmed/22574216 http://dx.doi.org/10.1371/journal.pone.0036704 Text en Judah et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Judah, David Rudkouskaya, Alena Wilson, Ryan Carter, David E. Dagnino, Lina Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title | Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title_full | Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title_fullStr | Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title_full_unstemmed | Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title_short | Multiple Roles of Integrin-Linked Kinase in Epidermal Development, Maturation and Pigmentation Revealed by Molecular Profiling |
title_sort | multiple roles of integrin-linked kinase in epidermal development, maturation and pigmentation revealed by molecular profiling |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3344928/ https://www.ncbi.nlm.nih.gov/pubmed/22574216 http://dx.doi.org/10.1371/journal.pone.0036704 |
work_keys_str_mv | AT judahdavid multiplerolesofintegrinlinkedkinaseinepidermaldevelopmentmaturationandpigmentationrevealedbymolecularprofiling AT rudkouskayaalena multiplerolesofintegrinlinkedkinaseinepidermaldevelopmentmaturationandpigmentationrevealedbymolecularprofiling AT wilsonryan multiplerolesofintegrinlinkedkinaseinepidermaldevelopmentmaturationandpigmentationrevealedbymolecularprofiling AT carterdavide multiplerolesofintegrinlinkedkinaseinepidermaldevelopmentmaturationandpigmentationrevealedbymolecularprofiling AT dagninolina multiplerolesofintegrinlinkedkinaseinepidermaldevelopmentmaturationandpigmentationrevealedbymolecularprofiling |