Cargando…
Vitamin D deficiency in newly diagnosed breast cancer patients
AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampl...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Medknow Publications & Media Pvt Ltd
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3354850/ https://www.ncbi.nlm.nih.gov/pubmed/22629509 http://dx.doi.org/10.4103/2230-8210.95684 |
_version_ | 1782233282914549760 |
---|---|
author | Imtiaz, Saba Siddiqui, Neelam Raza, Syed Abbas Loya, Asif Muhammad, Aasim |
author_facet | Imtiaz, Saba Siddiqui, Neelam Raza, Syed Abbas Loya, Asif Muhammad, Aasim |
author_sort | Imtiaz, Saba |
collection | PubMed |
description | AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampling over a period of 6 months for this case control study. Serum 25(OH)2D levels and CT bone mineral density was done. RESULTS: The mean age was 46±1.5 years. Age, marital status, menopausal, residential area, parda observing status, and body mass index were similar in distribution among cases and controls. The mean serum vitamin D level in the breast cancer patients was 9.3 ng/ml and in the control group was 14.9 ng/ml (P value <0.001). Vitamin D deficiency was seen in 95.6% (86) breast cancer patients and in 77% (69) of the control group (P value <0.001). Among the breast cancer patients the tumor characteristics (histology, grade, stage, and receptor status) did not show any significant associations with serum levels of vitamin D. Premenopausal breast cancer females had a mean serum vitamin D level of 10.5 ng/ml and postmenopausal females had a mean value of 13.5 ng/ml (P value 0.015). Low BMD did not correlate significantly with vitamin D deficiency (P value 0.787). CONCLUSION: Invariably almost all patients with breast cancer were vitamin D deficient. Tumor characteristics did not show any significant associations with serum levels of vitamin D. Bone mineral density did not correlate significantly with vitamin D deficiency. |
format | Online Article Text |
id | pubmed-3354850 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Medknow Publications & Media Pvt Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-33548502012-05-24 Vitamin D deficiency in newly diagnosed breast cancer patients Imtiaz, Saba Siddiqui, Neelam Raza, Syed Abbas Loya, Asif Muhammad, Aasim Indian J Endocrinol Metab Original Article AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampling over a period of 6 months for this case control study. Serum 25(OH)2D levels and CT bone mineral density was done. RESULTS: The mean age was 46±1.5 years. Age, marital status, menopausal, residential area, parda observing status, and body mass index were similar in distribution among cases and controls. The mean serum vitamin D level in the breast cancer patients was 9.3 ng/ml and in the control group was 14.9 ng/ml (P value <0.001). Vitamin D deficiency was seen in 95.6% (86) breast cancer patients and in 77% (69) of the control group (P value <0.001). Among the breast cancer patients the tumor characteristics (histology, grade, stage, and receptor status) did not show any significant associations with serum levels of vitamin D. Premenopausal breast cancer females had a mean serum vitamin D level of 10.5 ng/ml and postmenopausal females had a mean value of 13.5 ng/ml (P value 0.015). Low BMD did not correlate significantly with vitamin D deficiency (P value 0.787). CONCLUSION: Invariably almost all patients with breast cancer were vitamin D deficient. Tumor characteristics did not show any significant associations with serum levels of vitamin D. Bone mineral density did not correlate significantly with vitamin D deficiency. Medknow Publications & Media Pvt Ltd 2012 /pmc/articles/PMC3354850/ /pubmed/22629509 http://dx.doi.org/10.4103/2230-8210.95684 Text en Copyright: © Indian Journal of Endocrinology and Metabolism http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-Share Alike 3.0 Unported, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Imtiaz, Saba Siddiqui, Neelam Raza, Syed Abbas Loya, Asif Muhammad, Aasim Vitamin D deficiency in newly diagnosed breast cancer patients |
title | Vitamin D deficiency in newly diagnosed breast cancer patients |
title_full | Vitamin D deficiency in newly diagnosed breast cancer patients |
title_fullStr | Vitamin D deficiency in newly diagnosed breast cancer patients |
title_full_unstemmed | Vitamin D deficiency in newly diagnosed breast cancer patients |
title_short | Vitamin D deficiency in newly diagnosed breast cancer patients |
title_sort | vitamin d deficiency in newly diagnosed breast cancer patients |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3354850/ https://www.ncbi.nlm.nih.gov/pubmed/22629509 http://dx.doi.org/10.4103/2230-8210.95684 |
work_keys_str_mv | AT imtiazsaba vitaminddeficiencyinnewlydiagnosedbreastcancerpatients AT siddiquineelam vitaminddeficiencyinnewlydiagnosedbreastcancerpatients AT razasyedabbas vitaminddeficiencyinnewlydiagnosedbreastcancerpatients AT loyaasif vitaminddeficiencyinnewlydiagnosedbreastcancerpatients AT muhammadaasim vitaminddeficiencyinnewlydiagnosedbreastcancerpatients |