Cargando…

Vitamin D deficiency in newly diagnosed breast cancer patients

AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampl...

Descripción completa

Detalles Bibliográficos
Autores principales: Imtiaz, Saba, Siddiqui, Neelam, Raza, Syed Abbas, Loya, Asif, Muhammad, Aasim
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Medknow Publications & Media Pvt Ltd 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3354850/
https://www.ncbi.nlm.nih.gov/pubmed/22629509
http://dx.doi.org/10.4103/2230-8210.95684
_version_ 1782233282914549760
author Imtiaz, Saba
Siddiqui, Neelam
Raza, Syed Abbas
Loya, Asif
Muhammad, Aasim
author_facet Imtiaz, Saba
Siddiqui, Neelam
Raza, Syed Abbas
Loya, Asif
Muhammad, Aasim
author_sort Imtiaz, Saba
collection PubMed
description AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampling over a period of 6 months for this case control study. Serum 25(OH)2D levels and CT bone mineral density was done. RESULTS: The mean age was 46±1.5 years. Age, marital status, menopausal, residential area, parda observing status, and body mass index were similar in distribution among cases and controls. The mean serum vitamin D level in the breast cancer patients was 9.3 ng/ml and in the control group was 14.9 ng/ml (P value <0.001). Vitamin D deficiency was seen in 95.6% (86) breast cancer patients and in 77% (69) of the control group (P value <0.001). Among the breast cancer patients the tumor characteristics (histology, grade, stage, and receptor status) did not show any significant associations with serum levels of vitamin D. Premenopausal breast cancer females had a mean serum vitamin D level of 10.5 ng/ml and postmenopausal females had a mean value of 13.5 ng/ml (P value 0.015). Low BMD did not correlate significantly with vitamin D deficiency (P value 0.787). CONCLUSION: Invariably almost all patients with breast cancer were vitamin D deficient. Tumor characteristics did not show any significant associations with serum levels of vitamin D. Bone mineral density did not correlate significantly with vitamin D deficiency.
format Online
Article
Text
id pubmed-3354850
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Medknow Publications & Media Pvt Ltd
record_format MEDLINE/PubMed
spelling pubmed-33548502012-05-24 Vitamin D deficiency in newly diagnosed breast cancer patients Imtiaz, Saba Siddiqui, Neelam Raza, Syed Abbas Loya, Asif Muhammad, Aasim Indian J Endocrinol Metab Original Article AIM: The aim was to determine serum vitamin D levels in breast cancer patients and to assess its risk association with grade and stage of the tumor. MATERIALS AND METHODS: Ninety breast cancer patients and equal number of age-matched healthy females were recruited into the study by consecutive sampling over a period of 6 months for this case control study. Serum 25(OH)2D levels and CT bone mineral density was done. RESULTS: The mean age was 46±1.5 years. Age, marital status, menopausal, residential area, parda observing status, and body mass index were similar in distribution among cases and controls. The mean serum vitamin D level in the breast cancer patients was 9.3 ng/ml and in the control group was 14.9 ng/ml (P value <0.001). Vitamin D deficiency was seen in 95.6% (86) breast cancer patients and in 77% (69) of the control group (P value <0.001). Among the breast cancer patients the tumor characteristics (histology, grade, stage, and receptor status) did not show any significant associations with serum levels of vitamin D. Premenopausal breast cancer females had a mean serum vitamin D level of 10.5 ng/ml and postmenopausal females had a mean value of 13.5 ng/ml (P value 0.015). Low BMD did not correlate significantly with vitamin D deficiency (P value 0.787). CONCLUSION: Invariably almost all patients with breast cancer were vitamin D deficient. Tumor characteristics did not show any significant associations with serum levels of vitamin D. Bone mineral density did not correlate significantly with vitamin D deficiency. Medknow Publications & Media Pvt Ltd 2012 /pmc/articles/PMC3354850/ /pubmed/22629509 http://dx.doi.org/10.4103/2230-8210.95684 Text en Copyright: © Indian Journal of Endocrinology and Metabolism http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-Share Alike 3.0 Unported, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Imtiaz, Saba
Siddiqui, Neelam
Raza, Syed Abbas
Loya, Asif
Muhammad, Aasim
Vitamin D deficiency in newly diagnosed breast cancer patients
title Vitamin D deficiency in newly diagnosed breast cancer patients
title_full Vitamin D deficiency in newly diagnosed breast cancer patients
title_fullStr Vitamin D deficiency in newly diagnosed breast cancer patients
title_full_unstemmed Vitamin D deficiency in newly diagnosed breast cancer patients
title_short Vitamin D deficiency in newly diagnosed breast cancer patients
title_sort vitamin d deficiency in newly diagnosed breast cancer patients
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3354850/
https://www.ncbi.nlm.nih.gov/pubmed/22629509
http://dx.doi.org/10.4103/2230-8210.95684
work_keys_str_mv AT imtiazsaba vitaminddeficiencyinnewlydiagnosedbreastcancerpatients
AT siddiquineelam vitaminddeficiencyinnewlydiagnosedbreastcancerpatients
AT razasyedabbas vitaminddeficiencyinnewlydiagnosedbreastcancerpatients
AT loyaasif vitaminddeficiencyinnewlydiagnosedbreastcancerpatients
AT muhammadaasim vitaminddeficiencyinnewlydiagnosedbreastcancerpatients