Cargando…
Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance
We describe a novel form of tumor cell plasticity characterized by reversible adaptive plasticity in murine and human neuroblastoma. Two cellular phenotypes were defined by their ability to exhibit adhered, anchorage dependent (AD) or sphere forming, anchorage independent (AI) growth. The tumor cell...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Research Foundation
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3412992/ https://www.ncbi.nlm.nih.gov/pubmed/22891161 http://dx.doi.org/10.3389/fonc.2012.00082 |
_version_ | 1782240013897957376 |
---|---|
author | Chakrabarti, Lina Abou-Antoun, Thamara Vukmanovic, Stanislav Sandler, Anthony D. |
author_facet | Chakrabarti, Lina Abou-Antoun, Thamara Vukmanovic, Stanislav Sandler, Anthony D. |
author_sort | Chakrabarti, Lina |
collection | PubMed |
description | We describe a novel form of tumor cell plasticity characterized by reversible adaptive plasticity in murine and human neuroblastoma. Two cellular phenotypes were defined by their ability to exhibit adhered, anchorage dependent (AD) or sphere forming, anchorage independent (AI) growth. The tumor cells could transition back and forth between the two phenotypes and the transition was dependent on the culture conditions. Both cell phenotypes exhibited stem-like features such as expression of nestin, self-renewal capacity, and mesenchymal differentiation potential. The AI tumorspheres were found to be more resistant to chemotherapy and proliferated slower in vitro compared to the AD cells. Identification of specific molecular markers like MAP2, β-catenin, and PDGFRβ enabled us to characterize and observe both phenotypes in established mouse tumors. Irrespective of the phenotype originally implanted in mice, tumors grown in vivo show phenotypic heterogeneity in molecular marker signatures and are indistinguishable in growth or histologic appearance. Similar molecular marker heterogeneity was demonstrated in primary human tumor specimens. Chemotherapy or growth factor receptor inhibition slowed tumor growth in mice and promoted initial loss of AD or AI heterogeneity, respectively. Simultaneous targeting of both phenotypes led to further tumor growth delay with emergence of new unique phenotypes. Our results demonstrate that neuroblastoma cells are plastic, dynamic, and may optimize their ability to survive by changing their phenotype. Phenotypic switching appears to be an adaptive mechanism to unfavorable selection pressure and could explain the phenotypic and functional heterogeneity of neuroblastoma. |
format | Online Article Text |
id | pubmed-3412992 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Frontiers Research Foundation |
record_format | MEDLINE/PubMed |
spelling | pubmed-34129922012-08-13 Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance Chakrabarti, Lina Abou-Antoun, Thamara Vukmanovic, Stanislav Sandler, Anthony D. Front Oncol Oncology We describe a novel form of tumor cell plasticity characterized by reversible adaptive plasticity in murine and human neuroblastoma. Two cellular phenotypes were defined by their ability to exhibit adhered, anchorage dependent (AD) or sphere forming, anchorage independent (AI) growth. The tumor cells could transition back and forth between the two phenotypes and the transition was dependent on the culture conditions. Both cell phenotypes exhibited stem-like features such as expression of nestin, self-renewal capacity, and mesenchymal differentiation potential. The AI tumorspheres were found to be more resistant to chemotherapy and proliferated slower in vitro compared to the AD cells. Identification of specific molecular markers like MAP2, β-catenin, and PDGFRβ enabled us to characterize and observe both phenotypes in established mouse tumors. Irrespective of the phenotype originally implanted in mice, tumors grown in vivo show phenotypic heterogeneity in molecular marker signatures and are indistinguishable in growth or histologic appearance. Similar molecular marker heterogeneity was demonstrated in primary human tumor specimens. Chemotherapy or growth factor receptor inhibition slowed tumor growth in mice and promoted initial loss of AD or AI heterogeneity, respectively. Simultaneous targeting of both phenotypes led to further tumor growth delay with emergence of new unique phenotypes. Our results demonstrate that neuroblastoma cells are plastic, dynamic, and may optimize their ability to survive by changing their phenotype. Phenotypic switching appears to be an adaptive mechanism to unfavorable selection pressure and could explain the phenotypic and functional heterogeneity of neuroblastoma. Frontiers Research Foundation 2012-08-02 /pmc/articles/PMC3412992/ /pubmed/22891161 http://dx.doi.org/10.3389/fonc.2012.00082 Text en Copyright © 2012 Chakrabarti, Abou-Antoun, Vukmanovic and Sandler. http://www.frontiersin.org/licenseagreement This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits use, distribution and reproduction in other forums, provided the original authors and source are credited and subject to any copyright notices concerning any third-party graphics etc. |
spellingShingle | Oncology Chakrabarti, Lina Abou-Antoun, Thamara Vukmanovic, Stanislav Sandler, Anthony D. Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title | Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title_full | Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title_fullStr | Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title_full_unstemmed | Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title_short | Reversible Adaptive Plasticity: A Mechanism for Neuroblastoma Cell Heterogeneity and Chemo-Resistance |
title_sort | reversible adaptive plasticity: a mechanism for neuroblastoma cell heterogeneity and chemo-resistance |
topic | Oncology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3412992/ https://www.ncbi.nlm.nih.gov/pubmed/22891161 http://dx.doi.org/10.3389/fonc.2012.00082 |
work_keys_str_mv | AT chakrabartilina reversibleadaptiveplasticityamechanismforneuroblastomacellheterogeneityandchemoresistance AT abouantounthamara reversibleadaptiveplasticityamechanismforneuroblastomacellheterogeneityandchemoresistance AT vukmanovicstanislav reversibleadaptiveplasticityamechanismforneuroblastomacellheterogeneityandchemoresistance AT sandleranthonyd reversibleadaptiveplasticityamechanismforneuroblastomacellheterogeneityandchemoresistance |