Cargando…

Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma

BACKGROUND: BRAF(V600) inhibitors have offered a new gateway for better treatment of metastatic melanoma. However, the overall efficacy of BRAF(V600) inhibitors has been lower than expected in clinical trials, and many patients have shown resistance to the drug’s effect. We hypothesized that somatic...

Descripción completa

Detalles Bibliográficos
Autores principales: Shull, Austin Y., Latham-Schwark, Alicia, Ramasamy, Poornema, Leskoske, Kristin, Oroian, Dora, Birtwistle, Marc R., Buckhaults, Phillip J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3422312/
https://www.ncbi.nlm.nih.gov/pubmed/22912864
http://dx.doi.org/10.1371/journal.pone.0043369
_version_ 1782241034644750336
author Shull, Austin Y.
Latham-Schwark, Alicia
Ramasamy, Poornema
Leskoske, Kristin
Oroian, Dora
Birtwistle, Marc R.
Buckhaults, Phillip J.
author_facet Shull, Austin Y.
Latham-Schwark, Alicia
Ramasamy, Poornema
Leskoske, Kristin
Oroian, Dora
Birtwistle, Marc R.
Buckhaults, Phillip J.
author_sort Shull, Austin Y.
collection PubMed
description BACKGROUND: BRAF(V600) inhibitors have offered a new gateway for better treatment of metastatic melanoma. However, the overall efficacy of BRAF(V600) inhibitors has been lower than expected in clinical trials, and many patients have shown resistance to the drug’s effect. We hypothesized that somatic mutations in the Phosphoinositide 3-Kinase (PI3K) pathway, which promotes proliferation and survival, may coincide with BRAF(V600) mutations and contribute to chemotherapeutic resistance. METHODS: We performed a somatic mutation profiling study using the 454 FLX pyrosequencing platform in order to identify candidate cancer genes within the MAPK and PI3K pathways of melanoma patients. Somatic mutations of theses candidate cancer genes were then confirmed using Sanger sequencing. RESULTS: As expected, BRAF(V600) mutations were seen in 51% of the melanomas, whereas NRAS mutations were seen in 19% of the melanomas. However, PI3K pathway mutations, though more heterogeneous, were present in 41% of the melanoma, with PTEN being the highest mutated PI3K gene in melanomas (22%). Interestingly, several novel PI3K pathway mutations were discovered in MTOR, IRS4, PIK3R1, PIK3R4, PIK3R5, and NFKB1. PI3K pathway mutations co-occurred with BRAF(V600) mutations in 17% of the tumors and co-occurred with 9% of NRAS mutant tumors, implying cooperativity between these pathways in terms of melanoma progression. CONCLUSIONS: These novel PI3K pathway somatic mutations could provide alternative survival and proliferative pathways for metastatic melanoma cells. They therefore may be potential chemotherapeutic targets for melanoma patients who exhibit resistance to BRAF(V600) inhibitors.
format Online
Article
Text
id pubmed-3422312
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-34223122012-08-21 Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma Shull, Austin Y. Latham-Schwark, Alicia Ramasamy, Poornema Leskoske, Kristin Oroian, Dora Birtwistle, Marc R. Buckhaults, Phillip J. PLoS One Research Article BACKGROUND: BRAF(V600) inhibitors have offered a new gateway for better treatment of metastatic melanoma. However, the overall efficacy of BRAF(V600) inhibitors has been lower than expected in clinical trials, and many patients have shown resistance to the drug’s effect. We hypothesized that somatic mutations in the Phosphoinositide 3-Kinase (PI3K) pathway, which promotes proliferation and survival, may coincide with BRAF(V600) mutations and contribute to chemotherapeutic resistance. METHODS: We performed a somatic mutation profiling study using the 454 FLX pyrosequencing platform in order to identify candidate cancer genes within the MAPK and PI3K pathways of melanoma patients. Somatic mutations of theses candidate cancer genes were then confirmed using Sanger sequencing. RESULTS: As expected, BRAF(V600) mutations were seen in 51% of the melanomas, whereas NRAS mutations were seen in 19% of the melanomas. However, PI3K pathway mutations, though more heterogeneous, were present in 41% of the melanoma, with PTEN being the highest mutated PI3K gene in melanomas (22%). Interestingly, several novel PI3K pathway mutations were discovered in MTOR, IRS4, PIK3R1, PIK3R4, PIK3R5, and NFKB1. PI3K pathway mutations co-occurred with BRAF(V600) mutations in 17% of the tumors and co-occurred with 9% of NRAS mutant tumors, implying cooperativity between these pathways in terms of melanoma progression. CONCLUSIONS: These novel PI3K pathway somatic mutations could provide alternative survival and proliferative pathways for metastatic melanoma cells. They therefore may be potential chemotherapeutic targets for melanoma patients who exhibit resistance to BRAF(V600) inhibitors. Public Library of Science 2012-08-17 /pmc/articles/PMC3422312/ /pubmed/22912864 http://dx.doi.org/10.1371/journal.pone.0043369 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose.
spellingShingle Research Article
Shull, Austin Y.
Latham-Schwark, Alicia
Ramasamy, Poornema
Leskoske, Kristin
Oroian, Dora
Birtwistle, Marc R.
Buckhaults, Phillip J.
Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title_full Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title_fullStr Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title_full_unstemmed Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title_short Novel Somatic Mutations to PI3K Pathway Genes in Metastatic Melanoma
title_sort novel somatic mutations to pi3k pathway genes in metastatic melanoma
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3422312/
https://www.ncbi.nlm.nih.gov/pubmed/22912864
http://dx.doi.org/10.1371/journal.pone.0043369
work_keys_str_mv AT shullaustiny novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT lathamschwarkalicia novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT ramasamypoornema novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT leskoskekristin novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT oroiandora novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT birtwistlemarcr novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma
AT buckhaultsphillipj novelsomaticmutationstopi3kpathwaygenesinmetastaticmelanoma