Cargando…
High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been ident...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3467283/ https://www.ncbi.nlm.nih.gov/pubmed/23056185 http://dx.doi.org/10.1371/journal.pone.0044887 |
_version_ | 1782245780700004352 |
---|---|
author | Krausz, Csilla Giachini, Claudia Lo Giacco, Deborah Daguin, Fabrice Chianese, Chiara Ars, Elisabet Ruiz-Castane, Eduard Forti, Gianni Rossi, Elena |
author_facet | Krausz, Csilla Giachini, Claudia Lo Giacco, Deborah Daguin, Fabrice Chianese, Chiara Ars, Elisabet Ruiz-Castane, Eduard Forti, Gianni Rossi, Elena |
author_sort | Krausz, Csilla |
collection | PubMed |
description | CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been identified so far. OBJECTIVES: In order to advance our understanding of the role of X-linked genetic factors in male infertility, we applied high resolution X chromosome specific array-CGH in 199 men with different sperm count followed by the analysis of selected, patient-specific deletions in large groups of cases and normozoospermic controls. RESULTS: We identified 73 CNVs, among which 55 are novel, providing the largest collection of X-linked CNVs in relation to spermatogenesis. We found 12 patient-specific deletions with potential clinical implication. Cancer Testis Antigen gene family members were the most frequently affected genes, and represent new genetic targets in relationship with altered spermatogenesis. One of the most relevant findings of our study is the significantly higher global burden of deletions in patients compared to controls due to an excessive rate of deletions/person (0.57 versus 0.21, respectively; p = 8.785×10(−6)) and to a higher mean sequence loss/person (11.79 Kb and 8.13 Kb, respectively; p = 3.435×10(−4)). CONCLUSIONS: By the analysis of the X chromosome at the highest resolution available to date, in a large group of subjects with known sperm count we observed a deletion burden in relation to spermatogenic impairment and the lack of highly recurrent deletions on the X chromosome. We identified a number of potentially important patient-specific CNVs and candidate spermatogenesis genes, which represent novel targets for future investigations. |
format | Online Article Text |
id | pubmed-3467283 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-34672832012-10-10 High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males Krausz, Csilla Giachini, Claudia Lo Giacco, Deborah Daguin, Fabrice Chianese, Chiara Ars, Elisabet Ruiz-Castane, Eduard Forti, Gianni Rossi, Elena PLoS One Research Article CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been identified so far. OBJECTIVES: In order to advance our understanding of the role of X-linked genetic factors in male infertility, we applied high resolution X chromosome specific array-CGH in 199 men with different sperm count followed by the analysis of selected, patient-specific deletions in large groups of cases and normozoospermic controls. RESULTS: We identified 73 CNVs, among which 55 are novel, providing the largest collection of X-linked CNVs in relation to spermatogenesis. We found 12 patient-specific deletions with potential clinical implication. Cancer Testis Antigen gene family members were the most frequently affected genes, and represent new genetic targets in relationship with altered spermatogenesis. One of the most relevant findings of our study is the significantly higher global burden of deletions in patients compared to controls due to an excessive rate of deletions/person (0.57 versus 0.21, respectively; p = 8.785×10(−6)) and to a higher mean sequence loss/person (11.79 Kb and 8.13 Kb, respectively; p = 3.435×10(−4)). CONCLUSIONS: By the analysis of the X chromosome at the highest resolution available to date, in a large group of subjects with known sperm count we observed a deletion burden in relation to spermatogenic impairment and the lack of highly recurrent deletions on the X chromosome. We identified a number of potentially important patient-specific CNVs and candidate spermatogenesis genes, which represent novel targets for future investigations. Public Library of Science 2012-10-09 /pmc/articles/PMC3467283/ /pubmed/23056185 http://dx.doi.org/10.1371/journal.pone.0044887 Text en © 2012 Krausz et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Krausz, Csilla Giachini, Claudia Lo Giacco, Deborah Daguin, Fabrice Chianese, Chiara Ars, Elisabet Ruiz-Castane, Eduard Forti, Gianni Rossi, Elena High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title | High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title_full | High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title_fullStr | High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title_full_unstemmed | High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title_short | High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males |
title_sort | high resolution x chromosome-specific array-cgh detects new cnvs in infertile males |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3467283/ https://www.ncbi.nlm.nih.gov/pubmed/23056185 http://dx.doi.org/10.1371/journal.pone.0044887 |
work_keys_str_mv | AT krauszcsilla highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT giachiniclaudia highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT logiaccodeborah highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT daguinfabrice highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT chianesechiara highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT arselisabet highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT ruizcastaneeduard highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT fortigianni highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales AT rossielena highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales |