Cargando…

High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males

CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been ident...

Descripción completa

Detalles Bibliográficos
Autores principales: Krausz, Csilla, Giachini, Claudia, Lo Giacco, Deborah, Daguin, Fabrice, Chianese, Chiara, Ars, Elisabet, Ruiz-Castane, Eduard, Forti, Gianni, Rossi, Elena
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3467283/
https://www.ncbi.nlm.nih.gov/pubmed/23056185
http://dx.doi.org/10.1371/journal.pone.0044887
_version_ 1782245780700004352
author Krausz, Csilla
Giachini, Claudia
Lo Giacco, Deborah
Daguin, Fabrice
Chianese, Chiara
Ars, Elisabet
Ruiz-Castane, Eduard
Forti, Gianni
Rossi, Elena
author_facet Krausz, Csilla
Giachini, Claudia
Lo Giacco, Deborah
Daguin, Fabrice
Chianese, Chiara
Ars, Elisabet
Ruiz-Castane, Eduard
Forti, Gianni
Rossi, Elena
author_sort Krausz, Csilla
collection PubMed
description CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been identified so far. OBJECTIVES: In order to advance our understanding of the role of X-linked genetic factors in male infertility, we applied high resolution X chromosome specific array-CGH in 199 men with different sperm count followed by the analysis of selected, patient-specific deletions in large groups of cases and normozoospermic controls. RESULTS: We identified 73 CNVs, among which 55 are novel, providing the largest collection of X-linked CNVs in relation to spermatogenesis. We found 12 patient-specific deletions with potential clinical implication. Cancer Testis Antigen gene family members were the most frequently affected genes, and represent new genetic targets in relationship with altered spermatogenesis. One of the most relevant findings of our study is the significantly higher global burden of deletions in patients compared to controls due to an excessive rate of deletions/person (0.57 versus 0.21, respectively; p = 8.785×10(−6)) and to a higher mean sequence loss/person (11.79 Kb and 8.13 Kb, respectively; p = 3.435×10(−4)). CONCLUSIONS: By the analysis of the X chromosome at the highest resolution available to date, in a large group of subjects with known sperm count we observed a deletion burden in relation to spermatogenic impairment and the lack of highly recurrent deletions on the X chromosome. We identified a number of potentially important patient-specific CNVs and candidate spermatogenesis genes, which represent novel targets for future investigations.
format Online
Article
Text
id pubmed-3467283
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-34672832012-10-10 High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males Krausz, Csilla Giachini, Claudia Lo Giacco, Deborah Daguin, Fabrice Chianese, Chiara Ars, Elisabet Ruiz-Castane, Eduard Forti, Gianni Rossi, Elena PLoS One Research Article CONTEXT: The role of CNVs in male infertility is poorly defined, and only those linked to the Y chromosome have been the object of extensive research. Although it has been predicted that the X chromosome is also enriched in spermatogenesis genes, no clinically relevant gene mutations have been identified so far. OBJECTIVES: In order to advance our understanding of the role of X-linked genetic factors in male infertility, we applied high resolution X chromosome specific array-CGH in 199 men with different sperm count followed by the analysis of selected, patient-specific deletions in large groups of cases and normozoospermic controls. RESULTS: We identified 73 CNVs, among which 55 are novel, providing the largest collection of X-linked CNVs in relation to spermatogenesis. We found 12 patient-specific deletions with potential clinical implication. Cancer Testis Antigen gene family members were the most frequently affected genes, and represent new genetic targets in relationship with altered spermatogenesis. One of the most relevant findings of our study is the significantly higher global burden of deletions in patients compared to controls due to an excessive rate of deletions/person (0.57 versus 0.21, respectively; p = 8.785×10(−6)) and to a higher mean sequence loss/person (11.79 Kb and 8.13 Kb, respectively; p = 3.435×10(−4)). CONCLUSIONS: By the analysis of the X chromosome at the highest resolution available to date, in a large group of subjects with known sperm count we observed a deletion burden in relation to spermatogenic impairment and the lack of highly recurrent deletions on the X chromosome. We identified a number of potentially important patient-specific CNVs and candidate spermatogenesis genes, which represent novel targets for future investigations. Public Library of Science 2012-10-09 /pmc/articles/PMC3467283/ /pubmed/23056185 http://dx.doi.org/10.1371/journal.pone.0044887 Text en © 2012 Krausz et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Krausz, Csilla
Giachini, Claudia
Lo Giacco, Deborah
Daguin, Fabrice
Chianese, Chiara
Ars, Elisabet
Ruiz-Castane, Eduard
Forti, Gianni
Rossi, Elena
High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title_full High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title_fullStr High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title_full_unstemmed High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title_short High Resolution X Chromosome-Specific Array-CGH Detects New CNVs in Infertile Males
title_sort high resolution x chromosome-specific array-cgh detects new cnvs in infertile males
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3467283/
https://www.ncbi.nlm.nih.gov/pubmed/23056185
http://dx.doi.org/10.1371/journal.pone.0044887
work_keys_str_mv AT krauszcsilla highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT giachiniclaudia highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT logiaccodeborah highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT daguinfabrice highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT chianesechiara highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT arselisabet highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT ruizcastaneeduard highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT fortigianni highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales
AT rossielena highresolutionxchromosomespecificarraycghdetectsnewcnvsininfertilemales