Cargando…

Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells

An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures rela...

Descripción completa

Detalles Bibliográficos
Autores principales: Geissbuehler, Matthias, Kadlecova, Zuzana, Klok, Harm-Anton, Lasser, Theo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Optical Society of America 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3469990/
https://www.ncbi.nlm.nih.gov/pubmed/23082293
http://dx.doi.org/10.1364/BOE.3.002526
_version_ 1782246174383669248
author Geissbuehler, Matthias
Kadlecova, Zuzana
Klok, Harm-Anton
Lasser, Theo
author_facet Geissbuehler, Matthias
Kadlecova, Zuzana
Klok, Harm-Anton
Lasser, Theo
author_sort Geissbuehler, Matthias
collection PubMed
description An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures relative quantities of a transmembrane receptor and associated fluorescently labeled ligand during its recycling in living cells. Similarly to fluorescence-lifetime based methods, our approach is almost insensitive to photobleaching. A simple theory for unmixing two known triplet lifetimes is presented along with validation of the method by measurements of transferrin recycling in a model system based on chinese hamster ovarian cells (CHO). Transferrin is the delivery carrier for Fe(3+) to the cell.
format Online
Article
Text
id pubmed-3469990
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Optical Society of America
record_format MEDLINE/PubMed
spelling pubmed-34699902012-10-18 Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells Geissbuehler, Matthias Kadlecova, Zuzana Klok, Harm-Anton Lasser, Theo Biomed Opt Express Microscopy An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures relative quantities of a transmembrane receptor and associated fluorescently labeled ligand during its recycling in living cells. Similarly to fluorescence-lifetime based methods, our approach is almost insensitive to photobleaching. A simple theory for unmixing two known triplet lifetimes is presented along with validation of the method by measurements of transferrin recycling in a model system based on chinese hamster ovarian cells (CHO). Transferrin is the delivery carrier for Fe(3+) to the cell. Optical Society of America 2012-09-13 /pmc/articles/PMC3469990/ /pubmed/23082293 http://dx.doi.org/10.1364/BOE.3.002526 Text en © 2012 Optical Society of America http://creativecommons.org/licenses/by-nc-nd/3.0 This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 Unported License, which permits download and redistribution, provided that the original work is properly cited. This license restricts the article from being modified or used commercially.
spellingShingle Microscopy
Geissbuehler, Matthias
Kadlecova, Zuzana
Klok, Harm-Anton
Lasser, Theo
Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title_full Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title_fullStr Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title_full_unstemmed Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title_short Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
title_sort assessment of transferrin recycling by triplet lifetime imaging in living cells
topic Microscopy
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3469990/
https://www.ncbi.nlm.nih.gov/pubmed/23082293
http://dx.doi.org/10.1364/BOE.3.002526
work_keys_str_mv AT geissbuehlermatthias assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells
AT kadlecovazuzana assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells
AT klokharmanton assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells
AT lassertheo assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells