Cargando…
Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells
An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures rela...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Optical Society of America
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3469990/ https://www.ncbi.nlm.nih.gov/pubmed/23082293 http://dx.doi.org/10.1364/BOE.3.002526 |
_version_ | 1782246174383669248 |
---|---|
author | Geissbuehler, Matthias Kadlecova, Zuzana Klok, Harm-Anton Lasser, Theo |
author_facet | Geissbuehler, Matthias Kadlecova, Zuzana Klok, Harm-Anton Lasser, Theo |
author_sort | Geissbuehler, Matthias |
collection | PubMed |
description | An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures relative quantities of a transmembrane receptor and associated fluorescently labeled ligand during its recycling in living cells. Similarly to fluorescence-lifetime based methods, our approach is almost insensitive to photobleaching. A simple theory for unmixing two known triplet lifetimes is presented along with validation of the method by measurements of transferrin recycling in a model system based on chinese hamster ovarian cells (CHO). Transferrin is the delivery carrier for Fe(3+) to the cell. |
format | Online Article Text |
id | pubmed-3469990 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Optical Society of America |
record_format | MEDLINE/PubMed |
spelling | pubmed-34699902012-10-18 Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells Geissbuehler, Matthias Kadlecova, Zuzana Klok, Harm-Anton Lasser, Theo Biomed Opt Express Microscopy An optical method is presented that allows the measurement of the triplet lifetime of a fluorescent molecule. This is a characteristic specific to each fluorophore. Based on differences in triplet lifetimes of two fluorescent species (autofluorescence versus label), this novel approach measures relative quantities of a transmembrane receptor and associated fluorescently labeled ligand during its recycling in living cells. Similarly to fluorescence-lifetime based methods, our approach is almost insensitive to photobleaching. A simple theory for unmixing two known triplet lifetimes is presented along with validation of the method by measurements of transferrin recycling in a model system based on chinese hamster ovarian cells (CHO). Transferrin is the delivery carrier for Fe(3+) to the cell. Optical Society of America 2012-09-13 /pmc/articles/PMC3469990/ /pubmed/23082293 http://dx.doi.org/10.1364/BOE.3.002526 Text en © 2012 Optical Society of America http://creativecommons.org/licenses/by-nc-nd/3.0 This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 Unported License, which permits download and redistribution, provided that the original work is properly cited. This license restricts the article from being modified or used commercially. |
spellingShingle | Microscopy Geissbuehler, Matthias Kadlecova, Zuzana Klok, Harm-Anton Lasser, Theo Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title | Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title_full | Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title_fullStr | Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title_full_unstemmed | Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title_short | Assessment of transferrin recycling by Triplet Lifetime Imaging in living cells |
title_sort | assessment of transferrin recycling by triplet lifetime imaging in living cells |
topic | Microscopy |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3469990/ https://www.ncbi.nlm.nih.gov/pubmed/23082293 http://dx.doi.org/10.1364/BOE.3.002526 |
work_keys_str_mv | AT geissbuehlermatthias assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells AT kadlecovazuzana assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells AT klokharmanton assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells AT lassertheo assessmentoftransferrinrecyclingbytripletlifetimeimaginginlivingcells |