Cargando…
Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray
BACKGROUND: Seedlessness is an important agronomic trait for citrus, and male sterility (MS) is one main cause of seedless citrus fruit. However, the molecular mechanism of citrus seedlessness remained not well explored. RESULTS: An integrative strategy combining suppression subtractive hybridizatio...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3495689/ https://www.ncbi.nlm.nih.gov/pubmed/22897898 http://dx.doi.org/10.1186/1471-2164-13-397 |
_version_ | 1782249550652637184 |
---|---|
author | Qiu, Wen-Ming Zhu, An-Dan Wang, Yao Chai, Li-Jun Ge, Xiao-Xia Deng, Xiu-Xin Guo, Wen-Wu |
author_facet | Qiu, Wen-Ming Zhu, An-Dan Wang, Yao Chai, Li-Jun Ge, Xiao-Xia Deng, Xiu-Xin Guo, Wen-Wu |
author_sort | Qiu, Wen-Ming |
collection | PubMed |
description | BACKGROUND: Seedlessness is an important agronomic trait for citrus, and male sterility (MS) is one main cause of seedless citrus fruit. However, the molecular mechanism of citrus seedlessness remained not well explored. RESULTS: An integrative strategy combining suppression subtractive hybridization (SSH) library with cDNA microarray was employed to study the underlying mechanism of seedlessness of a Ponkan mandarin seedless mutant (Citrus reticulata Blanco). Screening with custom microarray, a total of 279 differentially expressed clones were identified, and 133 unigenes (43 contigs and 90 singletons) were obtained after sequencing. Gene Ontology (GO) distribution based on biological process suggested that the majority of differential genes are involved in metabolic process and respond to stimulus and regulation of biology process; based on molecular function they function as DNA/RNA binding or have catalytic activity and oxidoreductase activity. A gene encoding male sterility-like protein was highly up-regulated in the seedless mutant compared with the wild type, while several transcription factors (TFs) such as AP2/EREBP, MYB, WRKY, NAC and C2C2-GATA zinc-finger domain TFs were down-regulated. CONCLUSION: Our research highlighted some candidate pathways that participated in the citrus male gametophyte development and could be beneficial for seedless citrus breeding in the future. |
format | Online Article Text |
id | pubmed-3495689 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-34956892012-11-13 Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray Qiu, Wen-Ming Zhu, An-Dan Wang, Yao Chai, Li-Jun Ge, Xiao-Xia Deng, Xiu-Xin Guo, Wen-Wu BMC Genomics Research Article BACKGROUND: Seedlessness is an important agronomic trait for citrus, and male sterility (MS) is one main cause of seedless citrus fruit. However, the molecular mechanism of citrus seedlessness remained not well explored. RESULTS: An integrative strategy combining suppression subtractive hybridization (SSH) library with cDNA microarray was employed to study the underlying mechanism of seedlessness of a Ponkan mandarin seedless mutant (Citrus reticulata Blanco). Screening with custom microarray, a total of 279 differentially expressed clones were identified, and 133 unigenes (43 contigs and 90 singletons) were obtained after sequencing. Gene Ontology (GO) distribution based on biological process suggested that the majority of differential genes are involved in metabolic process and respond to stimulus and regulation of biology process; based on molecular function they function as DNA/RNA binding or have catalytic activity and oxidoreductase activity. A gene encoding male sterility-like protein was highly up-regulated in the seedless mutant compared with the wild type, while several transcription factors (TFs) such as AP2/EREBP, MYB, WRKY, NAC and C2C2-GATA zinc-finger domain TFs were down-regulated. CONCLUSION: Our research highlighted some candidate pathways that participated in the citrus male gametophyte development and could be beneficial for seedless citrus breeding in the future. BioMed Central 2012-08-16 /pmc/articles/PMC3495689/ /pubmed/22897898 http://dx.doi.org/10.1186/1471-2164-13-397 Text en Copyright ©2012 Qiu et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Qiu, Wen-Ming Zhu, An-Dan Wang, Yao Chai, Li-Jun Ge, Xiao-Xia Deng, Xiu-Xin Guo, Wen-Wu Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title | Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title_full | Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title_fullStr | Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title_full_unstemmed | Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title_short | Comparative transcript profiling of gene expression between seedless Ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cDNA microarray |
title_sort | comparative transcript profiling of gene expression between seedless ponkan mandarin and its seedy wild type during floral organ development by suppression subtractive hybridization and cdna microarray |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3495689/ https://www.ncbi.nlm.nih.gov/pubmed/22897898 http://dx.doi.org/10.1186/1471-2164-13-397 |
work_keys_str_mv | AT qiuwenming comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT zhuandan comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT wangyao comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT chailijun comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT gexiaoxia comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT dengxiuxin comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray AT guowenwu comparativetranscriptprofilingofgeneexpressionbetweenseedlessponkanmandarinanditsseedywildtypeduringfloralorgandevelopmentbysuppressionsubtractivehybridizationandcdnamicroarray |