Cargando…

Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8

The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-...

Descripción completa

Detalles Bibliográficos
Autores principales: Ma, Chao-Ying, Gao, Li-Yan, Li, Ning, Li, Xiao-Hui, Ma, Wu-Jun, Appels, Rudi, Yan, Yue-Ming
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Molecular Diversity Preservation International (MDPI) 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3497333/
https://www.ncbi.nlm.nih.gov/pubmed/23202959
http://dx.doi.org/10.3390/ijms131013398
_version_ 1782249740086280192
author Ma, Chao-Ying
Gao, Li-Yan
Li, Ning
Li, Xiao-Hui
Ma, Wu-Jun
Appels, Rudi
Yan, Yue-Ming
author_facet Ma, Chao-Ying
Gao, Li-Yan
Li, Ning
Li, Xiao-Hui
Ma, Wu-Jun
Appels, Rudi
Yan, Yue-Ming
author_sort Ma, Chao-Ying
collection PubMed
description The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-fold abundance variation (p < 0.05) in matured wheat grains and 21 spots were identified by tandem MALDI-TOF/TOF-MS. Among the identified spots, four were cultivar-specific, including three (spots B15, B16, and B21) in Chinese Spring and one in 3BS-8 (spot B10). Among variety-different DEPs between Chinese Spring and 3BS-8, most spots showed a higher express profile in CS; only four spots showed up-regulated expression tendency in 3BS-8. An interesting observation was that more than half of the identified protein spots were involved in storage proteins, of which 11 spots were identified as globulins. According to these results, we can presume that the encoded genes of protein spots B15, B16, and B21 were located on the chromosome segment deleted in 3BS-8.
format Online
Article
Text
id pubmed-3497333
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Molecular Diversity Preservation International (MDPI)
record_format MEDLINE/PubMed
spelling pubmed-34973332012-11-29 Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 Ma, Chao-Ying Gao, Li-Yan Li, Ning Li, Xiao-Hui Ma, Wu-Jun Appels, Rudi Yan, Yue-Ming Int J Mol Sci Article The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-fold abundance variation (p < 0.05) in matured wheat grains and 21 spots were identified by tandem MALDI-TOF/TOF-MS. Among the identified spots, four were cultivar-specific, including three (spots B15, B16, and B21) in Chinese Spring and one in 3BS-8 (spot B10). Among variety-different DEPs between Chinese Spring and 3BS-8, most spots showed a higher express profile in CS; only four spots showed up-regulated expression tendency in 3BS-8. An interesting observation was that more than half of the identified protein spots were involved in storage proteins, of which 11 spots were identified as globulins. According to these results, we can presume that the encoded genes of protein spots B15, B16, and B21 were located on the chromosome segment deleted in 3BS-8. Molecular Diversity Preservation International (MDPI) 2012-10-18 /pmc/articles/PMC3497333/ /pubmed/23202959 http://dx.doi.org/10.3390/ijms131013398 Text en © 2012 by the authors; licensee Molecular Diversity Preservation International, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0 This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0).
spellingShingle Article
Ma, Chao-Ying
Gao, Li-Yan
Li, Ning
Li, Xiao-Hui
Ma, Wu-Jun
Appels, Rudi
Yan, Yue-Ming
Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title_full Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title_fullStr Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title_full_unstemmed Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title_short Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
title_sort proteomic analysis of albumins and globulins from wheat variety chinese spring and its fine deletion line 3bs-8
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3497333/
https://www.ncbi.nlm.nih.gov/pubmed/23202959
http://dx.doi.org/10.3390/ijms131013398
work_keys_str_mv AT machaoying proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT gaoliyan proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT lining proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT lixiaohui proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT mawujun proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT appelsrudi proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8
AT yanyueming proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8