Cargando…
Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8
The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Molecular Diversity Preservation International (MDPI)
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3497333/ https://www.ncbi.nlm.nih.gov/pubmed/23202959 http://dx.doi.org/10.3390/ijms131013398 |
_version_ | 1782249740086280192 |
---|---|
author | Ma, Chao-Ying Gao, Li-Yan Li, Ning Li, Xiao-Hui Ma, Wu-Jun Appels, Rudi Yan, Yue-Ming |
author_facet | Ma, Chao-Ying Gao, Li-Yan Li, Ning Li, Xiao-Hui Ma, Wu-Jun Appels, Rudi Yan, Yue-Ming |
author_sort | Ma, Chao-Ying |
collection | PubMed |
description | The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-fold abundance variation (p < 0.05) in matured wheat grains and 21 spots were identified by tandem MALDI-TOF/TOF-MS. Among the identified spots, four were cultivar-specific, including three (spots B15, B16, and B21) in Chinese Spring and one in 3BS-8 (spot B10). Among variety-different DEPs between Chinese Spring and 3BS-8, most spots showed a higher express profile in CS; only four spots showed up-regulated expression tendency in 3BS-8. An interesting observation was that more than half of the identified protein spots were involved in storage proteins, of which 11 spots were identified as globulins. According to these results, we can presume that the encoded genes of protein spots B15, B16, and B21 were located on the chromosome segment deleted in 3BS-8. |
format | Online Article Text |
id | pubmed-3497333 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Molecular Diversity Preservation International (MDPI) |
record_format | MEDLINE/PubMed |
spelling | pubmed-34973332012-11-29 Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 Ma, Chao-Ying Gao, Li-Yan Li, Ning Li, Xiao-Hui Ma, Wu-Jun Appels, Rudi Yan, Yue-Ming Int J Mol Sci Article The relationship between chromosome deletion in wheat and protein expression were investigated using Chinese Spring and fine deletion line 3BS-8. Through 2-DE (2-D electrophoresis) analysis, no differentially expressed proteins (DEPs) were found in leaf samples; however, 47 DEPs showed at least two-fold abundance variation (p < 0.05) in matured wheat grains and 21 spots were identified by tandem MALDI-TOF/TOF-MS. Among the identified spots, four were cultivar-specific, including three (spots B15, B16, and B21) in Chinese Spring and one in 3BS-8 (spot B10). Among variety-different DEPs between Chinese Spring and 3BS-8, most spots showed a higher express profile in CS; only four spots showed up-regulated expression tendency in 3BS-8. An interesting observation was that more than half of the identified protein spots were involved in storage proteins, of which 11 spots were identified as globulins. According to these results, we can presume that the encoded genes of protein spots B15, B16, and B21 were located on the chromosome segment deleted in 3BS-8. Molecular Diversity Preservation International (MDPI) 2012-10-18 /pmc/articles/PMC3497333/ /pubmed/23202959 http://dx.doi.org/10.3390/ijms131013398 Text en © 2012 by the authors; licensee Molecular Diversity Preservation International, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0 This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0). |
spellingShingle | Article Ma, Chao-Ying Gao, Li-Yan Li, Ning Li, Xiao-Hui Ma, Wu-Jun Appels, Rudi Yan, Yue-Ming Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title | Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title_full | Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title_fullStr | Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title_full_unstemmed | Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title_short | Proteomic Analysis of Albumins and Globulins from Wheat Variety Chinese Spring and Its Fine Deletion Line 3BS-8 |
title_sort | proteomic analysis of albumins and globulins from wheat variety chinese spring and its fine deletion line 3bs-8 |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3497333/ https://www.ncbi.nlm.nih.gov/pubmed/23202959 http://dx.doi.org/10.3390/ijms131013398 |
work_keys_str_mv | AT machaoying proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT gaoliyan proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT lining proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT lixiaohui proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT mawujun proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT appelsrudi proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 AT yanyueming proteomicanalysisofalbuminsandglobulinsfromwheatvarietychinesespringanditsfinedeletionline3bs8 |