Cargando…
Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (Nor...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3499819/ https://www.ncbi.nlm.nih.gov/pubmed/23170172 http://dx.doi.org/10.3390/v4091548 |
_version_ | 1782250019530735616 |
---|---|
author | Friedman, Stephanie D. Snellgrove, Wyatt C. Genthner, Fred J. |
author_facet | Friedman, Stephanie D. Snellgrove, Wyatt C. Genthner, Fred J. |
author_sort | Friedman, Stephanie D. |
collection | PubMed |
description | Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (North Carolina and Rhode Island, USA), these strains shared 97% nucleotide similarity and 97–100% amino acid similarity. When the novel strains were compared to nine Levivirus genogroup I strains, they shared 95–100% similarity among the maturation, capsid and lysis proteins, but only 84–85% in the RNA-dependent RNA polymerase gene. Further bioinformatic analyses suggested a recombination event occurred. To the best of our knowledge, this is the first description of viral recombinants in environmental Leviviridae ssRNA bacteriophages. |
format | Online Article Text |
id | pubmed-3499819 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-34998192012-11-20 Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains Friedman, Stephanie D. Snellgrove, Wyatt C. Genthner, Fred J. Viruses Article Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (North Carolina and Rhode Island, USA), these strains shared 97% nucleotide similarity and 97–100% amino acid similarity. When the novel strains were compared to nine Levivirus genogroup I strains, they shared 95–100% similarity among the maturation, capsid and lysis proteins, but only 84–85% in the RNA-dependent RNA polymerase gene. Further bioinformatic analyses suggested a recombination event occurred. To the best of our knowledge, this is the first description of viral recombinants in environmental Leviviridae ssRNA bacteriophages. MDPI 2012-09-13 /pmc/articles/PMC3499819/ /pubmed/23170172 http://dx.doi.org/10.3390/v4091548 Text en © 2012 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Friedman, Stephanie D. Snellgrove, Wyatt C. Genthner, Fred J. Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title | Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title_full | Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title_fullStr | Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title_full_unstemmed | Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title_short | Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains |
title_sort | genomic sequences of two novel levivirus single-stranded rna coliphages (family leviviridae): evidence for recombinationin environmental strains |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3499819/ https://www.ncbi.nlm.nih.gov/pubmed/23170172 http://dx.doi.org/10.3390/v4091548 |
work_keys_str_mv | AT friedmanstephanied genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains AT snellgrovewyattc genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains AT genthnerfredj genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains |