Cargando…

Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains

Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (Nor...

Descripción completa

Detalles Bibliográficos
Autores principales: Friedman, Stephanie D., Snellgrove, Wyatt C., Genthner, Fred J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3499819/
https://www.ncbi.nlm.nih.gov/pubmed/23170172
http://dx.doi.org/10.3390/v4091548
_version_ 1782250019530735616
author Friedman, Stephanie D.
Snellgrove, Wyatt C.
Genthner, Fred J.
author_facet Friedman, Stephanie D.
Snellgrove, Wyatt C.
Genthner, Fred J.
author_sort Friedman, Stephanie D.
collection PubMed
description Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (North Carolina and Rhode Island, USA), these strains shared 97% nucleotide similarity and 97–100% amino acid similarity. When the novel strains were compared to nine Levivirus genogroup I strains, they shared 95–100% similarity among the maturation, capsid and lysis proteins, but only 84–85% in the RNA-dependent RNA polymerase gene. Further bioinformatic analyses suggested a recombination event occurred. To the best of our knowledge, this is the first description of viral recombinants in environmental Leviviridae ssRNA bacteriophages.
format Online
Article
Text
id pubmed-3499819
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-34998192012-11-20 Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains Friedman, Stephanie D. Snellgrove, Wyatt C. Genthner, Fred J. Viruses Article Bacteriophages are likely the most abundant entities in the aquatic environment, yet knowledge of their ecology is limited. During a fecal source-tracking study, two genetically novel Leviviridae strains were discovered. Although the novel strains were isolated from coastal waters 1130 km apart (North Carolina and Rhode Island, USA), these strains shared 97% nucleotide similarity and 97–100% amino acid similarity. When the novel strains were compared to nine Levivirus genogroup I strains, they shared 95–100% similarity among the maturation, capsid and lysis proteins, but only 84–85% in the RNA-dependent RNA polymerase gene. Further bioinformatic analyses suggested a recombination event occurred. To the best of our knowledge, this is the first description of viral recombinants in environmental Leviviridae ssRNA bacteriophages. MDPI 2012-09-13 /pmc/articles/PMC3499819/ /pubmed/23170172 http://dx.doi.org/10.3390/v4091548 Text en © 2012 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
spellingShingle Article
Friedman, Stephanie D.
Snellgrove, Wyatt C.
Genthner, Fred J.
Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title_full Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title_fullStr Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title_full_unstemmed Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title_short Genomic Sequences of two Novel Levivirus Single-Stranded RNA Coliphages (Family Leviviridae): Evidence for Recombinationin Environmental Strains
title_sort genomic sequences of two novel levivirus single-stranded rna coliphages (family leviviridae): evidence for recombinationin environmental strains
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3499819/
https://www.ncbi.nlm.nih.gov/pubmed/23170172
http://dx.doi.org/10.3390/v4091548
work_keys_str_mv AT friedmanstephanied genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains
AT snellgrovewyattc genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains
AT genthnerfredj genomicsequencesoftwonovellevivirussinglestrandedrnacoliphagesfamilyleviviridaeevidenceforrecombinationinenvironmentalstrains