Cargando…

A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations

Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to ve...

Descripción completa

Detalles Bibliográficos
Autores principales: Jenkins, Brian, Decker, Helena, Bentley, Marvin, Luisi, Julie, Banker, Gary
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Rockefeller University Press 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3514038/
https://www.ncbi.nlm.nih.gov/pubmed/22908316
http://dx.doi.org/10.1083/jcb.201205070
_version_ 1782251953796939776
author Jenkins, Brian
Decker, Helena
Bentley, Marvin
Luisi, Julie
Banker, Gary
author_facet Jenkins, Brian
Decker, Helena
Bentley, Marvin
Luisi, Julie
Banker, Gary
author_sort Jenkins, Brian
collection PubMed
description Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to vesicles undergoing dendrite-selective transport in cultured hippocampal neurons. We prepared a library of “split kinesins,” comprising an axon-selective kinesin motor domain and a series of kinesin tail domains that can attach to their native vesicles; when the split kinesins were assembled by chemical dimerization, bound vesicles were misdirected into the axon. This method provided highly specific results, showing that three Kinesin-3 family members—KIF1A, KIF13A, and KIF13B—interacted with dendritic vesicle populations. This experimental paradigm allows a systematic approach to evaluate motor–vesicle interactions in living cells.
format Online
Article
Text
id pubmed-3514038
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher The Rockefeller University Press
record_format MEDLINE/PubMed
spelling pubmed-35140382013-02-20 A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations Jenkins, Brian Decker, Helena Bentley, Marvin Luisi, Julie Banker, Gary J Cell Biol Research Articles Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to vesicles undergoing dendrite-selective transport in cultured hippocampal neurons. We prepared a library of “split kinesins,” comprising an axon-selective kinesin motor domain and a series of kinesin tail domains that can attach to their native vesicles; when the split kinesins were assembled by chemical dimerization, bound vesicles were misdirected into the axon. This method provided highly specific results, showing that three Kinesin-3 family members—KIF1A, KIF13A, and KIF13B—interacted with dendritic vesicle populations. This experimental paradigm allows a systematic approach to evaluate motor–vesicle interactions in living cells. The Rockefeller University Press 2012-08-20 /pmc/articles/PMC3514038/ /pubmed/22908316 http://dx.doi.org/10.1083/jcb.201205070 Text en © 2012 Jenkins et al. https://creativecommons.org/licenses/by-nc-sa/3.0/This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/ (https://creativecommons.org/licenses/by-nc-sa/3.0/) ).
spellingShingle Research Articles
Jenkins, Brian
Decker, Helena
Bentley, Marvin
Luisi, Julie
Banker, Gary
A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title_full A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title_fullStr A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title_full_unstemmed A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title_short A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
title_sort novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3514038/
https://www.ncbi.nlm.nih.gov/pubmed/22908316
http://dx.doi.org/10.1083/jcb.201205070
work_keys_str_mv AT jenkinsbrian anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT deckerhelena anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT bentleymarvin anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT luisijulie anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT bankergary anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT jenkinsbrian novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT deckerhelena novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT bentleymarvin novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT luisijulie novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations
AT bankergary novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations