Cargando…
A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations
Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to ve...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Rockefeller University Press
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3514038/ https://www.ncbi.nlm.nih.gov/pubmed/22908316 http://dx.doi.org/10.1083/jcb.201205070 |
_version_ | 1782251953796939776 |
---|---|
author | Jenkins, Brian Decker, Helena Bentley, Marvin Luisi, Julie Banker, Gary |
author_facet | Jenkins, Brian Decker, Helena Bentley, Marvin Luisi, Julie Banker, Gary |
author_sort | Jenkins, Brian |
collection | PubMed |
description | Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to vesicles undergoing dendrite-selective transport in cultured hippocampal neurons. We prepared a library of “split kinesins,” comprising an axon-selective kinesin motor domain and a series of kinesin tail domains that can attach to their native vesicles; when the split kinesins were assembled by chemical dimerization, bound vesicles were misdirected into the axon. This method provided highly specific results, showing that three Kinesin-3 family members—KIF1A, KIF13A, and KIF13B—interacted with dendritic vesicle populations. This experimental paradigm allows a systematic approach to evaluate motor–vesicle interactions in living cells. |
format | Online Article Text |
id | pubmed-3514038 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | The Rockefeller University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-35140382013-02-20 A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations Jenkins, Brian Decker, Helena Bentley, Marvin Luisi, Julie Banker, Gary J Cell Biol Research Articles Identifying the kinesin motors that interact with different vesicle populations is a longstanding and challenging problem with implications for many aspects of cell biology. Here we introduce a new live-cell assay to assess kinesin–vesicle interactions and use it to identify kinesins that bind to vesicles undergoing dendrite-selective transport in cultured hippocampal neurons. We prepared a library of “split kinesins,” comprising an axon-selective kinesin motor domain and a series of kinesin tail domains that can attach to their native vesicles; when the split kinesins were assembled by chemical dimerization, bound vesicles were misdirected into the axon. This method provided highly specific results, showing that three Kinesin-3 family members—KIF1A, KIF13A, and KIF13B—interacted with dendritic vesicle populations. This experimental paradigm allows a systematic approach to evaluate motor–vesicle interactions in living cells. The Rockefeller University Press 2012-08-20 /pmc/articles/PMC3514038/ /pubmed/22908316 http://dx.doi.org/10.1083/jcb.201205070 Text en © 2012 Jenkins et al. https://creativecommons.org/licenses/by-nc-sa/3.0/This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/ (https://creativecommons.org/licenses/by-nc-sa/3.0/) ). |
spellingShingle | Research Articles Jenkins, Brian Decker, Helena Bentley, Marvin Luisi, Julie Banker, Gary A novel split kinesin assay identifies motor proteins that interact with distinct vesicle populations |
title | A novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
title_full | A novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
title_fullStr | A novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
title_full_unstemmed | A novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
title_short | A novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
title_sort | novel split kinesin assay identifies motor proteins that interact
with distinct vesicle populations |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3514038/ https://www.ncbi.nlm.nih.gov/pubmed/22908316 http://dx.doi.org/10.1083/jcb.201205070 |
work_keys_str_mv | AT jenkinsbrian anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT deckerhelena anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT bentleymarvin anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT luisijulie anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT bankergary anovelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT jenkinsbrian novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT deckerhelena novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT bentleymarvin novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT luisijulie novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations AT bankergary novelsplitkinesinassayidentifiesmotorproteinsthatinteractwithdistinctvesiclepopulations |