Cargando…
17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis...
Autores principales: | , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3519464/ https://www.ncbi.nlm.nih.gov/pubmed/23251351 http://dx.doi.org/10.1371/journal.pone.0049828 |
_version_ | 1782252666225688576 |
---|---|
author | Campi-Azevedo, Ana Carolina de Araújo-Porto, Luiza Pacheco Luiza-Silva, Maria Batista, Maurício Azevedo Martins, Marina Angela Sathler-Avelar, Renato da Silveira-Lemos, Denise Camacho, Luiz Antonio Bastos de Menezes Martins, Reinaldo de Lourdes de Sousa Maia, Maria Farias, Roberto Henrique Guedes da Silva Freire, Marcos Galler, Ricardo Homma, Akira Ribeiro, José Geraldo Leite Lemos, Jandira Aparecida Campos Auxiliadora-Martins, Maria Caldas, Iramaya Rodrigues Elói-Santos, Silvana Maria Teixeira-Carvalho, Andréa Martins-Filho, Olindo Assis |
author_facet | Campi-Azevedo, Ana Carolina de Araújo-Porto, Luiza Pacheco Luiza-Silva, Maria Batista, Maurício Azevedo Martins, Marina Angela Sathler-Avelar, Renato da Silveira-Lemos, Denise Camacho, Luiz Antonio Bastos de Menezes Martins, Reinaldo de Lourdes de Sousa Maia, Maria Farias, Roberto Henrique Guedes da Silva Freire, Marcos Galler, Ricardo Homma, Akira Ribeiro, José Geraldo Leite Lemos, Jandira Aparecida Campos Auxiliadora-Martins, Maria Caldas, Iramaya Rodrigues Elói-Santos, Silvana Maria Teixeira-Carvalho, Andréa Martins-Filho, Olindo Assis |
author_sort | Campi-Azevedo, Ana Carolina |
collection | PubMed |
description | BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(−)). Following revaccination with the YF-17DD, the PV-PRNT(−) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(−) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization. |
format | Online Article Text |
id | pubmed-3519464 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-35194642012-12-18 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children Campi-Azevedo, Ana Carolina de Araújo-Porto, Luiza Pacheco Luiza-Silva, Maria Batista, Maurício Azevedo Martins, Marina Angela Sathler-Avelar, Renato da Silveira-Lemos, Denise Camacho, Luiz Antonio Bastos de Menezes Martins, Reinaldo de Lourdes de Sousa Maia, Maria Farias, Roberto Henrique Guedes da Silva Freire, Marcos Galler, Ricardo Homma, Akira Ribeiro, José Geraldo Leite Lemos, Jandira Aparecida Campos Auxiliadora-Martins, Maria Caldas, Iramaya Rodrigues Elói-Santos, Silvana Maria Teixeira-Carvalho, Andréa Martins-Filho, Olindo Assis PLoS One Research Article BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(−)). Following revaccination with the YF-17DD, the PV-PRNT(−) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(−) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization. Public Library of Science 2012-12-10 /pmc/articles/PMC3519464/ /pubmed/23251351 http://dx.doi.org/10.1371/journal.pone.0049828 Text en © 2012 Campi-Azevedo et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Campi-Azevedo, Ana Carolina de Araújo-Porto, Luiza Pacheco Luiza-Silva, Maria Batista, Maurício Azevedo Martins, Marina Angela Sathler-Avelar, Renato da Silveira-Lemos, Denise Camacho, Luiz Antonio Bastos de Menezes Martins, Reinaldo de Lourdes de Sousa Maia, Maria Farias, Roberto Henrique Guedes da Silva Freire, Marcos Galler, Ricardo Homma, Akira Ribeiro, José Geraldo Leite Lemos, Jandira Aparecida Campos Auxiliadora-Martins, Maria Caldas, Iramaya Rodrigues Elói-Santos, Silvana Maria Teixeira-Carvalho, Andréa Martins-Filho, Olindo Assis 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title | 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title_full | 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title_fullStr | 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title_full_unstemmed | 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title_short | 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children |
title_sort | 17dd and 17d-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3519464/ https://www.ncbi.nlm.nih.gov/pubmed/23251351 http://dx.doi.org/10.1371/journal.pone.0049828 |
work_keys_str_mv | AT campiazevedoanacarolina 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT dearaujoportoluizapacheco 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT luizasilvamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT batistamauricioazevedo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT martinsmarinaangela 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT sathleravelarrenato 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT dasilveiralemosdenise 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT camacholuizantoniobastos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT demenezesmartinsreinaldo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT delourdesdesousamaiamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT fariasrobertohenriqueguedes 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT dasilvafreiremarcos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT gallerricardo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT hommaakira 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT ribeirojosegeraldoleite 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT lemosjandiraaparecidacampos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT auxiliadoramartinsmaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT caldasiramayarodrigues 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT eloisantossilvanamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT teixeiracarvalhoandrea 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren AT martinsfilhoolindoassis 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren |