Cargando…

17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children

BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis...

Descripción completa

Detalles Bibliográficos
Autores principales: Campi-Azevedo, Ana Carolina, de Araújo-Porto, Luiza Pacheco, Luiza-Silva, Maria, Batista, Maurício Azevedo, Martins, Marina Angela, Sathler-Avelar, Renato, da Silveira-Lemos, Denise, Camacho, Luiz Antonio Bastos, de Menezes Martins, Reinaldo, de Lourdes de Sousa Maia, Maria, Farias, Roberto Henrique Guedes, da Silva Freire, Marcos, Galler, Ricardo, Homma, Akira, Ribeiro, José Geraldo Leite, Lemos, Jandira Aparecida Campos, Auxiliadora-Martins, Maria, Caldas, Iramaya Rodrigues, Elói-Santos, Silvana Maria, Teixeira-Carvalho, Andréa, Martins-Filho, Olindo Assis
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3519464/
https://www.ncbi.nlm.nih.gov/pubmed/23251351
http://dx.doi.org/10.1371/journal.pone.0049828
_version_ 1782252666225688576
author Campi-Azevedo, Ana Carolina
de Araújo-Porto, Luiza Pacheco
Luiza-Silva, Maria
Batista, Maurício Azevedo
Martins, Marina Angela
Sathler-Avelar, Renato
da Silveira-Lemos, Denise
Camacho, Luiz Antonio Bastos
de Menezes Martins, Reinaldo
de Lourdes de Sousa Maia, Maria
Farias, Roberto Henrique Guedes
da Silva Freire, Marcos
Galler, Ricardo
Homma, Akira
Ribeiro, José Geraldo Leite
Lemos, Jandira Aparecida Campos
Auxiliadora-Martins, Maria
Caldas, Iramaya Rodrigues
Elói-Santos, Silvana Maria
Teixeira-Carvalho, Andréa
Martins-Filho, Olindo Assis
author_facet Campi-Azevedo, Ana Carolina
de Araújo-Porto, Luiza Pacheco
Luiza-Silva, Maria
Batista, Maurício Azevedo
Martins, Marina Angela
Sathler-Avelar, Renato
da Silveira-Lemos, Denise
Camacho, Luiz Antonio Bastos
de Menezes Martins, Reinaldo
de Lourdes de Sousa Maia, Maria
Farias, Roberto Henrique Guedes
da Silva Freire, Marcos
Galler, Ricardo
Homma, Akira
Ribeiro, José Geraldo Leite
Lemos, Jandira Aparecida Campos
Auxiliadora-Martins, Maria
Caldas, Iramaya Rodrigues
Elói-Santos, Silvana Maria
Teixeira-Carvalho, Andréa
Martins-Filho, Olindo Assis
author_sort Campi-Azevedo, Ana Carolina
collection PubMed
description BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(−)). Following revaccination with the YF-17DD, the PV-PRNT(−) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(−) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization.
format Online
Article
Text
id pubmed-3519464
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-35194642012-12-18 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children Campi-Azevedo, Ana Carolina de Araújo-Porto, Luiza Pacheco Luiza-Silva, Maria Batista, Maurício Azevedo Martins, Marina Angela Sathler-Avelar, Renato da Silveira-Lemos, Denise Camacho, Luiz Antonio Bastos de Menezes Martins, Reinaldo de Lourdes de Sousa Maia, Maria Farias, Roberto Henrique Guedes da Silva Freire, Marcos Galler, Ricardo Homma, Akira Ribeiro, José Geraldo Leite Lemos, Jandira Aparecida Campos Auxiliadora-Martins, Maria Caldas, Iramaya Rodrigues Elói-Santos, Silvana Maria Teixeira-Carvalho, Andréa Martins-Filho, Olindo Assis PLoS One Research Article BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF) substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV) children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT) and referred to as seroconverters (PV-PRNT(+)) or nonseroconverters (PV-PRNT(−)). Following revaccination with the YF-17DD, the PV-PRNT(−) children (YF-17D-213/77 and YF-17DD groups) seroconverted and were referred as RV-PRNT(+). The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control) as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+), with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+) in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+)CD8(+) T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(−) children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+)T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D-213/77 nonresponders. CONCLUSION: Our findings demonstrated that, just like the YF-17DD reference vaccine, the YF-17D-213/77 seed lot induced a mixed pattern of inflammatory and regulatory cytokines, supporting its universal use for immunization. Public Library of Science 2012-12-10 /pmc/articles/PMC3519464/ /pubmed/23251351 http://dx.doi.org/10.1371/journal.pone.0049828 Text en © 2012 Campi-Azevedo et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Campi-Azevedo, Ana Carolina
de Araújo-Porto, Luiza Pacheco
Luiza-Silva, Maria
Batista, Maurício Azevedo
Martins, Marina Angela
Sathler-Avelar, Renato
da Silveira-Lemos, Denise
Camacho, Luiz Antonio Bastos
de Menezes Martins, Reinaldo
de Lourdes de Sousa Maia, Maria
Farias, Roberto Henrique Guedes
da Silva Freire, Marcos
Galler, Ricardo
Homma, Akira
Ribeiro, José Geraldo Leite
Lemos, Jandira Aparecida Campos
Auxiliadora-Martins, Maria
Caldas, Iramaya Rodrigues
Elói-Santos, Silvana Maria
Teixeira-Carvalho, Andréa
Martins-Filho, Olindo Assis
17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title_full 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title_fullStr 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title_full_unstemmed 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title_short 17DD and 17D-213/77 Yellow Fever Substrains Trigger a Balanced Cytokine Profile in Primary Vaccinated Children
title_sort 17dd and 17d-213/77 yellow fever substrains trigger a balanced cytokine profile in primary vaccinated children
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3519464/
https://www.ncbi.nlm.nih.gov/pubmed/23251351
http://dx.doi.org/10.1371/journal.pone.0049828
work_keys_str_mv AT campiazevedoanacarolina 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT dearaujoportoluizapacheco 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT luizasilvamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT batistamauricioazevedo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT martinsmarinaangela 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT sathleravelarrenato 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT dasilveiralemosdenise 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT camacholuizantoniobastos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT demenezesmartinsreinaldo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT delourdesdesousamaiamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT fariasrobertohenriqueguedes 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT dasilvafreiremarcos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT gallerricardo 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT hommaakira 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT ribeirojosegeraldoleite 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT lemosjandiraaparecidacampos 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT auxiliadoramartinsmaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT caldasiramayarodrigues 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT eloisantossilvanamaria 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT teixeiracarvalhoandrea 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren
AT martinsfilhoolindoassis 17ddand17d21377yellowfeversubstrainstriggerabalancedcytokineprofileinprimaryvaccinatedchildren