Cargando…

In Silico Characterization of Histidine Acid Phytase Sequences

Histidine acid phytases (HAPhy) are widely distributed enzymes among bacteria, fungi, plants, and some animal tissues. They have a significant role as an animal feed enzyme and in the solubilization of insoluble phosphates and minerals present in the form of phytic acid complex. A set of 50 referenc...

Descripción completa

Detalles Bibliográficos
Autores principales: Kumar, Vinod, Singh, Gopal, Verma, A. K., Agrawal, Sanjeev
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3523131/
https://www.ncbi.nlm.nih.gov/pubmed/23304454
http://dx.doi.org/10.1155/2012/845465
_version_ 1782253177025855488
author Kumar, Vinod
Singh, Gopal
Verma, A. K.
Agrawal, Sanjeev
author_facet Kumar, Vinod
Singh, Gopal
Verma, A. K.
Agrawal, Sanjeev
author_sort Kumar, Vinod
collection PubMed
description Histidine acid phytases (HAPhy) are widely distributed enzymes among bacteria, fungi, plants, and some animal tissues. They have a significant role as an animal feed enzyme and in the solubilization of insoluble phosphates and minerals present in the form of phytic acid complex. A set of 50 reference protein sequences representing HAPhy were retrieved from NCBI protein database and characterized for various biochemical properties, multiple sequence alignment (MSA), homology search, phylogenetic analysis, motifs, and superfamily search. MSA using MEGA5 revealed the presence of conserved sequences at N-terminal “RHGXRXP” and C-terminal “HD.” Phylogenetic tree analysis indicates the presence of three clusters representing different HAPhy, that is, PhyA, PhyB, and AppA. Analysis of 10 commonly distributed motifs in the sequences indicates the presence of signature sequence for each class. Motif 1 “SPFCDLFTHEEWIQYDYLQSLGKYYGYGAGNPLGPAQGIGF” was present in 38 protein sequences representing clusters 1 (PhyA) and 2 (PhyB). Cluster 3 (AppA) contains motif 9 “KKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDP” as a signature sequence. All sequences belong to histidine acid phosphatase family as resulted from superfamily search. No conserved sequence representing 3- or 6-phytase could be identified using multiple sequence alignment. This in silico analysis might contribute in the classification and future genetic engineering of this most diverse class of phytase.
format Online
Article
Text
id pubmed-3523131
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-35231312013-01-09 In Silico Characterization of Histidine Acid Phytase Sequences Kumar, Vinod Singh, Gopal Verma, A. K. Agrawal, Sanjeev Enzyme Res Research Article Histidine acid phytases (HAPhy) are widely distributed enzymes among bacteria, fungi, plants, and some animal tissues. They have a significant role as an animal feed enzyme and in the solubilization of insoluble phosphates and minerals present in the form of phytic acid complex. A set of 50 reference protein sequences representing HAPhy were retrieved from NCBI protein database and characterized for various biochemical properties, multiple sequence alignment (MSA), homology search, phylogenetic analysis, motifs, and superfamily search. MSA using MEGA5 revealed the presence of conserved sequences at N-terminal “RHGXRXP” and C-terminal “HD.” Phylogenetic tree analysis indicates the presence of three clusters representing different HAPhy, that is, PhyA, PhyB, and AppA. Analysis of 10 commonly distributed motifs in the sequences indicates the presence of signature sequence for each class. Motif 1 “SPFCDLFTHEEWIQYDYLQSLGKYYGYGAGNPLGPAQGIGF” was present in 38 protein sequences representing clusters 1 (PhyA) and 2 (PhyB). Cluster 3 (AppA) contains motif 9 “KKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDP” as a signature sequence. All sequences belong to histidine acid phosphatase family as resulted from superfamily search. No conserved sequence representing 3- or 6-phytase could be identified using multiple sequence alignment. This in silico analysis might contribute in the classification and future genetic engineering of this most diverse class of phytase. Hindawi Publishing Corporation 2012 2012-12-05 /pmc/articles/PMC3523131/ /pubmed/23304454 http://dx.doi.org/10.1155/2012/845465 Text en Copyright © 2012 Vinod Kumar et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Kumar, Vinod
Singh, Gopal
Verma, A. K.
Agrawal, Sanjeev
In Silico Characterization of Histidine Acid Phytase Sequences
title In Silico Characterization of Histidine Acid Phytase Sequences
title_full In Silico Characterization of Histidine Acid Phytase Sequences
title_fullStr In Silico Characterization of Histidine Acid Phytase Sequences
title_full_unstemmed In Silico Characterization of Histidine Acid Phytase Sequences
title_short In Silico Characterization of Histidine Acid Phytase Sequences
title_sort in silico characterization of histidine acid phytase sequences
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3523131/
https://www.ncbi.nlm.nih.gov/pubmed/23304454
http://dx.doi.org/10.1155/2012/845465
work_keys_str_mv AT kumarvinod insilicocharacterizationofhistidineacidphytasesequences
AT singhgopal insilicocharacterizationofhistidineacidphytasesequences
AT vermaak insilicocharacterizationofhistidineacidphytasesequences
AT agrawalsanjeev insilicocharacterizationofhistidineacidphytasesequences