Cargando…
Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome
BACKGROUND: Left cardiac sympathetic denervation (LCSD) may be a therapeutic adjunct for young patients with catecholaminergic polymorphic ventricular tachycardia (CPVT) and long QT syndrome (LQTS) who are not fully protected by beta-blockade. OBJECTIVE: The objective of this analysis was to report...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer-Verlag
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3536998/ https://www.ncbi.nlm.nih.gov/pubmed/22821214 http://dx.doi.org/10.1007/s00392-012-0492-7 |
_version_ | 1782254837035958272 |
---|---|
author | Schneider, Heike E. Steinmetz, Michael Krause, Ulrich Kriebel, Thomas Ruschewski, Wolfgang Paul, Thomas |
author_facet | Schneider, Heike E. Steinmetz, Michael Krause, Ulrich Kriebel, Thomas Ruschewski, Wolfgang Paul, Thomas |
author_sort | Schneider, Heike E. |
collection | PubMed |
description | BACKGROUND: Left cardiac sympathetic denervation (LCSD) may be a therapeutic adjunct for young patients with catecholaminergic polymorphic ventricular tachycardia (CPVT) and long QT syndrome (LQTS) who are not fully protected by beta-blockade. OBJECTIVE: The objective of this analysis was to report our institutional experience with LSCD in young patients for the management of life-threatening ventricular arrhythmias in CPVT and LQTS. METHODS: Ten young patients with CPVT and LQTS underwent transaxillary LSCD at our institution. Mean age at surgery was 14.0 (range 3.9–42) years, mean body weight was 45.7 (range 15.5–90) kg. Five patients had the clinical diagnosis of CPVT, three were genotype positive for a mutation in the ryanodine-receptor-2-gene. Four of five LQTS patients were genotype positive. Indications for LCSD were recurrent syncope, symptomatic episodes of ventricular tachycardias and/or internal cardioverter–defibrillator (ICD) discharges, and aborted cardiac arrest despite high doses of beta-blockers. RESULTS: LCSD was performed via the transaxillary approach. No significant complications were observed. Two patients already had an ICD, 6 patients received an ICD at the same operation or shortly thereafter. Median length of follow-up after LCSD was 2.3 (range 0.6–3.9) years. After LCSD a marked reduction in arrhythmia burden and cardiac events was observed in all patients while medication was continued. None of the patients had any further ICD discharge for sustained VT. CONCLUSIONS: After LCSD, arrhythmia burden could significantly be reduced in all our young patients with CPVT and LQTS. |
format | Online Article Text |
id | pubmed-3536998 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Springer-Verlag |
record_format | MEDLINE/PubMed |
spelling | pubmed-35369982013-01-04 Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome Schneider, Heike E. Steinmetz, Michael Krause, Ulrich Kriebel, Thomas Ruschewski, Wolfgang Paul, Thomas Clin Res Cardiol Original Paper BACKGROUND: Left cardiac sympathetic denervation (LCSD) may be a therapeutic adjunct for young patients with catecholaminergic polymorphic ventricular tachycardia (CPVT) and long QT syndrome (LQTS) who are not fully protected by beta-blockade. OBJECTIVE: The objective of this analysis was to report our institutional experience with LSCD in young patients for the management of life-threatening ventricular arrhythmias in CPVT and LQTS. METHODS: Ten young patients with CPVT and LQTS underwent transaxillary LSCD at our institution. Mean age at surgery was 14.0 (range 3.9–42) years, mean body weight was 45.7 (range 15.5–90) kg. Five patients had the clinical diagnosis of CPVT, three were genotype positive for a mutation in the ryanodine-receptor-2-gene. Four of five LQTS patients were genotype positive. Indications for LCSD were recurrent syncope, symptomatic episodes of ventricular tachycardias and/or internal cardioverter–defibrillator (ICD) discharges, and aborted cardiac arrest despite high doses of beta-blockers. RESULTS: LCSD was performed via the transaxillary approach. No significant complications were observed. Two patients already had an ICD, 6 patients received an ICD at the same operation or shortly thereafter. Median length of follow-up after LCSD was 2.3 (range 0.6–3.9) years. After LCSD a marked reduction in arrhythmia burden and cardiac events was observed in all patients while medication was continued. None of the patients had any further ICD discharge for sustained VT. CONCLUSIONS: After LCSD, arrhythmia burden could significantly be reduced in all our young patients with CPVT and LQTS. Springer-Verlag 2012-07-21 2013 /pmc/articles/PMC3536998/ /pubmed/22821214 http://dx.doi.org/10.1007/s00392-012-0492-7 Text en © The Author(s) 2012 https://creativecommons.org/licenses/by/4.0/ This article is distributed under the terms of the Creative Commons Attribution License which permits any use, distribution, and reproduction in any medium, provided the original author(s) and the source are credited. |
spellingShingle | Original Paper Schneider, Heike E. Steinmetz, Michael Krause, Ulrich Kriebel, Thomas Ruschewski, Wolfgang Paul, Thomas Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title | Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title_full | Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title_fullStr | Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title_full_unstemmed | Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title_short | Left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long QT syndrome |
title_sort | left cardiac sympathetic denervation for the management of life-threatening ventricular tachyarrhythmias in young patients with catecholaminergic polymorphic ventricular tachycardia and long qt syndrome |
topic | Original Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3536998/ https://www.ncbi.nlm.nih.gov/pubmed/22821214 http://dx.doi.org/10.1007/s00392-012-0492-7 |
work_keys_str_mv | AT schneiderheikee leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome AT steinmetzmichael leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome AT krauseulrich leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome AT kriebelthomas leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome AT ruschewskiwolfgang leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome AT paulthomas leftcardiacsympatheticdenervationforthemanagementoflifethreateningventriculartachyarrhythmiasinyoungpatientswithcatecholaminergicpolymorphicventriculartachycardiaandlongqtsyndrome |