Cargando…
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3561266/ https://www.ncbi.nlm.nih.gov/pubmed/23383164 http://dx.doi.org/10.1371/journal.pone.0055350 |
_version_ | 1782257941973303296 |
---|---|
author | Shen, Yue Wu, Lijun Xi, Bo Liu, Xin Zhao, Xiaoyuan Cheng, Hong Hou, Dongqing Wang, Xingyu Mi, Jie |
author_facet | Shen, Yue Wu, Lijun Xi, Bo Liu, Xin Zhao, Xiaoyuan Cheng, Hong Hou, Dongqing Wang, Xingyu Mi, Jie |
author_sort | Shen, Yue |
collection | PubMed |
description | BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = −0.07; for rs1260333, β = −0.07) and HOMA-IR (p<0.05. for rs1260326, β = −0.03; for rs1260333, β = −0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69–1.00) for rs1260326, and 0.83 (95%CI 0.68–1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58–0.88) for rs1260326, and 0.72 (95%CI 0.58–0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76–0.94) and 0.85 (95%CI 0.76–0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children. |
format | Online Article Text |
id | pubmed-3561266 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-35612662013-02-04 GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children Shen, Yue Wu, Lijun Xi, Bo Liu, Xin Zhao, Xiaoyuan Cheng, Hong Hou, Dongqing Wang, Xingyu Mi, Jie PLoS One Research Article BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = −0.07; for rs1260333, β = −0.07) and HOMA-IR (p<0.05. for rs1260326, β = −0.03; for rs1260333, β = −0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69–1.00) for rs1260326, and 0.83 (95%CI 0.68–1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58–0.88) for rs1260326, and 0.72 (95%CI 0.58–0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76–0.94) and 0.85 (95%CI 0.76–0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children. Public Library of Science 2013-01-31 /pmc/articles/PMC3561266/ /pubmed/23383164 http://dx.doi.org/10.1371/journal.pone.0055350 Text en © 2013 Shen et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Shen, Yue Wu, Lijun Xi, Bo Liu, Xin Zhao, Xiaoyuan Cheng, Hong Hou, Dongqing Wang, Xingyu Mi, Jie GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title |
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title_full |
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title_fullStr |
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title_full_unstemmed |
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title_short |
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children |
title_sort | gckr variants increase triglycerides while protecting from insulin resistance in chinese children |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3561266/ https://www.ncbi.nlm.nih.gov/pubmed/23383164 http://dx.doi.org/10.1371/journal.pone.0055350 |
work_keys_str_mv | AT shenyue gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT wulijun gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT xibo gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT liuxin gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT zhaoxiaoyuan gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT chenghong gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT houdongqing gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT wangxingyu gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren AT mijie gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren |