Cargando…

GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children

BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS...

Descripción completa

Detalles Bibliográficos
Autores principales: Shen, Yue, Wu, Lijun, Xi, Bo, Liu, Xin, Zhao, Xiaoyuan, Cheng, Hong, Hou, Dongqing, Wang, Xingyu, Mi, Jie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3561266/
https://www.ncbi.nlm.nih.gov/pubmed/23383164
http://dx.doi.org/10.1371/journal.pone.0055350
_version_ 1782257941973303296
author Shen, Yue
Wu, Lijun
Xi, Bo
Liu, Xin
Zhao, Xiaoyuan
Cheng, Hong
Hou, Dongqing
Wang, Xingyu
Mi, Jie
author_facet Shen, Yue
Wu, Lijun
Xi, Bo
Liu, Xin
Zhao, Xiaoyuan
Cheng, Hong
Hou, Dongqing
Wang, Xingyu
Mi, Jie
author_sort Shen, Yue
collection PubMed
description BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = −0.07; for rs1260333, β = −0.07) and HOMA-IR (p<0.05. for rs1260326, β = −0.03; for rs1260333, β = −0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69–1.00) for rs1260326, and 0.83 (95%CI 0.68–1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58–0.88) for rs1260326, and 0.72 (95%CI 0.58–0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76–0.94) and 0.85 (95%CI 0.76–0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children.
format Online
Article
Text
id pubmed-3561266
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-35612662013-02-04 GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children Shen, Yue Wu, Lijun Xi, Bo Liu, Xin Zhao, Xiaoyuan Cheng, Hong Hou, Dongqing Wang, Xingyu Mi, Jie PLoS One Research Article BACKGROUND: Variants in gene encoding glucokinase regulator protein (GCKR) were found to have converse effects on triglycerides and glucose metabolic traits. We aimed to investigate the influence of GCKR variants for triglycerides and glucose metabolic traits in Chinese children and adults. METHODS AND RESULTS: We genotyped two GCKR variants rs1260326 and rs1260333 in children and adults, and analyzed the association between two variants and triglycerides, glucose, insulin and HOMA-IR using linear regression model, and estimated the effect on insulin resistance using logistic regression model. Rs1260326 and rs1260333 associated with increased triglycerides in children and adults (p<0.05). In children, both variants significantly reduced insulin (p<0.05. for rs1260326, β = −0.07; for rs1260333, β = −0.07) and HOMA-IR (p<0.05. for rs1260326, β = −0.03; for rs1260333, β = −0.03). There were significant associations between two variants and insulin resistance for children. Under co-dominant model, for CT vs. CC, OR is 0.83 (95%CI 0.69–1.00) for rs1260326, and 0.83 (95%CI 0.68–1.00) for rs1260333; for TT vs. CC, OR is 0.72 (95%CI 0.58–0.88) for rs1260326, and 0.72 (95%CI 0.58–0.89) for rs1260333. Under allele model, for allele T vs. C, the ORs are 0.85 (95%CI 0.76–0.94) and 0.85 (95%CI 0.76–0.94) for rs1260326 and rs1260333, respectively). CONCLUSIONS: Our study confirmed the associations between GCKR variants and triglycerides in Chinese children and adults. Triglycerides-increasing alleles of GCKR variants reduce insulin and HOMA-IR index, and protect from insulin resistance in children. Our results suggested GCKR has an effect on development of insulin resistance in Chinese children. Public Library of Science 2013-01-31 /pmc/articles/PMC3561266/ /pubmed/23383164 http://dx.doi.org/10.1371/journal.pone.0055350 Text en © 2013 Shen et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Shen, Yue
Wu, Lijun
Xi, Bo
Liu, Xin
Zhao, Xiaoyuan
Cheng, Hong
Hou, Dongqing
Wang, Xingyu
Mi, Jie
GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title_full GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title_fullStr GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title_full_unstemmed GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title_short GCKR Variants Increase Triglycerides While Protecting from Insulin Resistance in Chinese Children
title_sort gckr variants increase triglycerides while protecting from insulin resistance in chinese children
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3561266/
https://www.ncbi.nlm.nih.gov/pubmed/23383164
http://dx.doi.org/10.1371/journal.pone.0055350
work_keys_str_mv AT shenyue gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT wulijun gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT xibo gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT liuxin gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT zhaoxiaoyuan gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT chenghong gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT houdongqing gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT wangxingyu gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren
AT mijie gckrvariantsincreasetriglycerideswhileprotectingfrominsulinresistanceinchinesechildren