Cargando…
Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers
Type-I interferon (IFN-I) has been increasingly implicated in HIV-1 pathogenesis. Various studies have shown elevated IFN-I and an IFN-I-induced gene and protein expression signature in HIV-1 infection, yet the elevated IFN-I species has not been conclusively identified, its source remains obscure a...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3577907/ https://www.ncbi.nlm.nih.gov/pubmed/23437155 http://dx.doi.org/10.1371/journal.pone.0056527 |
_version_ | 1782260001541193728 |
---|---|
author | Hardy, Gareth A. D. Sieg, Scott Rodriguez, Benigno Anthony, Donald Asaad, Robert Jiang, Wei Mudd, Joseph Schacker, Timothy Funderburg, Nicholas T. Pilch-Cooper, Heather A. Debernardo, Robert Rabin, Ronald L. Lederman, Michael M. Harding, Clifford V. |
author_facet | Hardy, Gareth A. D. Sieg, Scott Rodriguez, Benigno Anthony, Donald Asaad, Robert Jiang, Wei Mudd, Joseph Schacker, Timothy Funderburg, Nicholas T. Pilch-Cooper, Heather A. Debernardo, Robert Rabin, Ronald L. Lederman, Michael M. Harding, Clifford V. |
author_sort | Hardy, Gareth A. D. |
collection | PubMed |
description | Type-I interferon (IFN-I) has been increasingly implicated in HIV-1 pathogenesis. Various studies have shown elevated IFN-I and an IFN-I-induced gene and protein expression signature in HIV-1 infection, yet the elevated IFN-I species has not been conclusively identified, its source remains obscure and its role in driving HIV-1 pathogenesis is controversial. We assessed IFN-I species in plasma by ELISAs and bioassay, and we investigated potential sources of IFN-I in blood and lymph node tissue by qRT-PCR. Furthermore, we measured the effect of therapeutic administration of IFNα in HCV-infected subjects to model the effect of IFNα on chronic immune activation. IFN-I bioactivity was significantly increased in plasma of untreated HIV-1-infected subjects relative to uninfected subjects (p = 0.012), and IFNα was the predominant IFN-I subtype correlating with IFN-I bioactivity (r = 0.658, p<0.001). IFNα was not detectable in plasma of subjects receiving anti-retroviral therapy. Elevated expression of IFNα mRNA was limited to lymph node tissue cells, suggesting that peripheral blood leukocytes are not a major source of IFNα in untreated chronic HIV-1 infection. Plasma IFN-I levels correlated inversely with CD4 T cell count (p = 0.003) and positively with levels of plasma HIV-1 RNA and CD38 expression on CD8 T cells (p = 0.009). In hepatitis C virus-infected subjects, treatment with IFN-I and ribavirin increased expression of CD38 on CD8 T cells (p = 0.003). These studies identify IFNα derived from lymph nodes, rather than blood leukocytes, as a possible source of the IFN-I signature that contributes to immune activation in HIV-1 infection. |
format | Online Article Text |
id | pubmed-3577907 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-35779072013-02-22 Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers Hardy, Gareth A. D. Sieg, Scott Rodriguez, Benigno Anthony, Donald Asaad, Robert Jiang, Wei Mudd, Joseph Schacker, Timothy Funderburg, Nicholas T. Pilch-Cooper, Heather A. Debernardo, Robert Rabin, Ronald L. Lederman, Michael M. Harding, Clifford V. PLoS One Research Article Type-I interferon (IFN-I) has been increasingly implicated in HIV-1 pathogenesis. Various studies have shown elevated IFN-I and an IFN-I-induced gene and protein expression signature in HIV-1 infection, yet the elevated IFN-I species has not been conclusively identified, its source remains obscure and its role in driving HIV-1 pathogenesis is controversial. We assessed IFN-I species in plasma by ELISAs and bioassay, and we investigated potential sources of IFN-I in blood and lymph node tissue by qRT-PCR. Furthermore, we measured the effect of therapeutic administration of IFNα in HCV-infected subjects to model the effect of IFNα on chronic immune activation. IFN-I bioactivity was significantly increased in plasma of untreated HIV-1-infected subjects relative to uninfected subjects (p = 0.012), and IFNα was the predominant IFN-I subtype correlating with IFN-I bioactivity (r = 0.658, p<0.001). IFNα was not detectable in plasma of subjects receiving anti-retroviral therapy. Elevated expression of IFNα mRNA was limited to lymph node tissue cells, suggesting that peripheral blood leukocytes are not a major source of IFNα in untreated chronic HIV-1 infection. Plasma IFN-I levels correlated inversely with CD4 T cell count (p = 0.003) and positively with levels of plasma HIV-1 RNA and CD38 expression on CD8 T cells (p = 0.009). In hepatitis C virus-infected subjects, treatment with IFN-I and ribavirin increased expression of CD38 on CD8 T cells (p = 0.003). These studies identify IFNα derived from lymph nodes, rather than blood leukocytes, as a possible source of the IFN-I signature that contributes to immune activation in HIV-1 infection. Public Library of Science 2013-02-20 /pmc/articles/PMC3577907/ /pubmed/23437155 http://dx.doi.org/10.1371/journal.pone.0056527 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. |
spellingShingle | Research Article Hardy, Gareth A. D. Sieg, Scott Rodriguez, Benigno Anthony, Donald Asaad, Robert Jiang, Wei Mudd, Joseph Schacker, Timothy Funderburg, Nicholas T. Pilch-Cooper, Heather A. Debernardo, Robert Rabin, Ronald L. Lederman, Michael M. Harding, Clifford V. Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title | Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title_full | Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title_fullStr | Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title_full_unstemmed | Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title_short | Interferon-α Is the Primary Plasma Type-I IFN in HIV-1 Infection and Correlates with Immune Activation and Disease Markers |
title_sort | interferon-α is the primary plasma type-i ifn in hiv-1 infection and correlates with immune activation and disease markers |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3577907/ https://www.ncbi.nlm.nih.gov/pubmed/23437155 http://dx.doi.org/10.1371/journal.pone.0056527 |
work_keys_str_mv | AT hardygarethad interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT siegscott interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT rodriguezbenigno interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT anthonydonald interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT asaadrobert interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT jiangwei interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT muddjoseph interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT schackertimothy interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT funderburgnicholast interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT pilchcooperheathera interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT debernardorobert interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT rabinronaldl interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT ledermanmichaelm interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers AT hardingcliffordv interferonaistheprimaryplasmatypeiifninhiv1infectionandcorrelateswithimmuneactivationanddiseasemarkers |