Cargando…
Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
[Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events....
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Chemical Society
2013
|
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3592331/ https://www.ncbi.nlm.nih.gov/pubmed/23317476 http://dx.doi.org/10.1021/jf3046076 |
_version_ | 1782262104493916160 |
---|---|
author | Majumder, Kaustav Chakrabarti, Subhadeep Davidge, Sandra T. Wu, Jianping |
author_facet | Majumder, Kaustav Chakrabarti, Subhadeep Davidge, Sandra T. Wu, Jianping |
author_sort | Majumder, Kaustav |
collection | PubMed |
description | [Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events. Whereas IRW significantly inhibited TNF-induced up-regulation of intercellular cell adhesion molecule-I (ICAM-1) and vascular cell adhesion molecule-I (VCAM-1), IQW could inhibit only the up-regulation of ICAM-1. The anti-inflammatory effects of these peptides appeared to be mediated by the nuclear factor-κB (NF-κB) pathway, which was differentially regulated by IRW and IQW. Both IRW and IQW exhibited antioxidant effects as shown by reduction of TNF-induced superoxide generation. The structural integrity of these peptides was essential for their activities, because dipeptides or the combination of constituent amino acids did not exhibit the same effect. This study demonstrated the significance of the structural integrity of these two tripeptides in attenuating endothelial inflammation and oxidative stress, indicating their potential as nutraceuticals. |
format | Online Article Text |
id | pubmed-3592331 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | American Chemical Society |
record_format | MEDLINE/PubMed |
spelling | pubmed-35923312013-03-12 Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress Majumder, Kaustav Chakrabarti, Subhadeep Davidge, Sandra T. Wu, Jianping J Agric Food Chem [Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events. Whereas IRW significantly inhibited TNF-induced up-regulation of intercellular cell adhesion molecule-I (ICAM-1) and vascular cell adhesion molecule-I (VCAM-1), IQW could inhibit only the up-regulation of ICAM-1. The anti-inflammatory effects of these peptides appeared to be mediated by the nuclear factor-κB (NF-κB) pathway, which was differentially regulated by IRW and IQW. Both IRW and IQW exhibited antioxidant effects as shown by reduction of TNF-induced superoxide generation. The structural integrity of these peptides was essential for their activities, because dipeptides or the combination of constituent amino acids did not exhibit the same effect. This study demonstrated the significance of the structural integrity of these two tripeptides in attenuating endothelial inflammation and oxidative stress, indicating their potential as nutraceuticals. American Chemical Society 2013-01-15 2013-03-06 /pmc/articles/PMC3592331/ /pubmed/23317476 http://dx.doi.org/10.1021/jf3046076 Text en Copyright © 2013 American Chemical Society |
spellingShingle | Majumder, Kaustav Chakrabarti, Subhadeep Davidge, Sandra T. Wu, Jianping Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress |
title | Structure and Activity Study of Egg Protein Ovotransferrin
Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response
and Oxidative Stress |
title_full | Structure and Activity Study of Egg Protein Ovotransferrin
Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response
and Oxidative Stress |
title_fullStr | Structure and Activity Study of Egg Protein Ovotransferrin
Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response
and Oxidative Stress |
title_full_unstemmed | Structure and Activity Study of Egg Protein Ovotransferrin
Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response
and Oxidative Stress |
title_short | Structure and Activity Study of Egg Protein Ovotransferrin
Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response
and Oxidative Stress |
title_sort | structure and activity study of egg protein ovotransferrin
derived peptides (irw and iqw) on endothelial inflammatory response
and oxidative stress |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3592331/ https://www.ncbi.nlm.nih.gov/pubmed/23317476 http://dx.doi.org/10.1021/jf3046076 |
work_keys_str_mv | AT majumderkaustav structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress AT chakrabartisubhadeep structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress AT davidgesandrat structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress AT wujianping structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress |