Cargando…

Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress

[Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events....

Descripción completa

Detalles Bibliográficos
Autores principales: Majumder, Kaustav, Chakrabarti, Subhadeep, Davidge, Sandra T., Wu, Jianping
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Chemical Society 2013
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3592331/
https://www.ncbi.nlm.nih.gov/pubmed/23317476
http://dx.doi.org/10.1021/jf3046076
_version_ 1782262104493916160
author Majumder, Kaustav
Chakrabarti, Subhadeep
Davidge, Sandra T.
Wu, Jianping
author_facet Majumder, Kaustav
Chakrabarti, Subhadeep
Davidge, Sandra T.
Wu, Jianping
author_sort Majumder, Kaustav
collection PubMed
description [Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events. Whereas IRW significantly inhibited TNF-induced up-regulation of intercellular cell adhesion molecule-I (ICAM-1) and vascular cell adhesion molecule-I (VCAM-1), IQW could inhibit only the up-regulation of ICAM-1. The anti-inflammatory effects of these peptides appeared to be mediated by the nuclear factor-κB (NF-κB) pathway, which was differentially regulated by IRW and IQW. Both IRW and IQW exhibited antioxidant effects as shown by reduction of TNF-induced superoxide generation. The structural integrity of these peptides was essential for their activities, because dipeptides or the combination of constituent amino acids did not exhibit the same effect. This study demonstrated the significance of the structural integrity of these two tripeptides in attenuating endothelial inflammation and oxidative stress, indicating their potential as nutraceuticals.
format Online
Article
Text
id pubmed-3592331
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher American Chemical Society
record_format MEDLINE/PubMed
spelling pubmed-35923312013-03-12 Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress Majumder, Kaustav Chakrabarti, Subhadeep Davidge, Sandra T. Wu, Jianping J Agric Food Chem [Image: see text] Egg protein ovotransferrin derived peptides (IRW and IQW) can attenuate tumor necrosis factor (TNF) induced inflammatory responses and oxidative stress in endothelial cells. The present study investigates the structural requirements and molecular mechanisms underlying these events. Whereas IRW significantly inhibited TNF-induced up-regulation of intercellular cell adhesion molecule-I (ICAM-1) and vascular cell adhesion molecule-I (VCAM-1), IQW could inhibit only the up-regulation of ICAM-1. The anti-inflammatory effects of these peptides appeared to be mediated by the nuclear factor-κB (NF-κB) pathway, which was differentially regulated by IRW and IQW. Both IRW and IQW exhibited antioxidant effects as shown by reduction of TNF-induced superoxide generation. The structural integrity of these peptides was essential for their activities, because dipeptides or the combination of constituent amino acids did not exhibit the same effect. This study demonstrated the significance of the structural integrity of these two tripeptides in attenuating endothelial inflammation and oxidative stress, indicating their potential as nutraceuticals. American Chemical Society 2013-01-15 2013-03-06 /pmc/articles/PMC3592331/ /pubmed/23317476 http://dx.doi.org/10.1021/jf3046076 Text en Copyright © 2013 American Chemical Society
spellingShingle Majumder, Kaustav
Chakrabarti, Subhadeep
Davidge, Sandra T.
Wu, Jianping
Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title_full Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title_fullStr Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title_full_unstemmed Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title_short Structure and Activity Study of Egg Protein Ovotransferrin Derived Peptides (IRW and IQW) on Endothelial Inflammatory Response and Oxidative Stress
title_sort structure and activity study of egg protein ovotransferrin derived peptides (irw and iqw) on endothelial inflammatory response and oxidative stress
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3592331/
https://www.ncbi.nlm.nih.gov/pubmed/23317476
http://dx.doi.org/10.1021/jf3046076
work_keys_str_mv AT majumderkaustav structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress
AT chakrabartisubhadeep structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress
AT davidgesandrat structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress
AT wujianping structureandactivitystudyofeggproteinovotransferrinderivedpeptidesirwandiqwonendothelialinflammatoryresponseandoxidativestress