Cargando…

Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements

A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred f...

Descripción completa

Detalles Bibliográficos
Autores principales: Pilla Reddy, V, Petersson, K J, Suleiman, A A, Vermeulen, A, Proost, J H, Friberg, L E
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3603470/
https://www.ncbi.nlm.nih.gov/pubmed/23835881
http://dx.doi.org/10.1038/psp.2012.9
_version_ 1782263688357478400
author Pilla Reddy, V
Petersson, K J
Suleiman, A A
Vermeulen, A
Proost, J H
Friberg, L E
author_facet Pilla Reddy, V
Petersson, K J
Suleiman, A A
Vermeulen, A
Proost, J H
Friberg, L E
author_sort Pilla Reddy, V
collection PubMed
description A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred from mean plasma concentrations, have shown the incidence of EPS to rise when receptor occupancy is above ~80%. In this analysis, individual longitudinal EPS data from 2,630 patients participating in one of seven different trials and treated with haloperidol, paliperidone, ziprasidone, olanzapine, JNJ-37822681, or placebo were analyzed using a continuous time probability model with Markov elements. The developed pharmacokinetic–pharmacodynamic model describes the longitudinal changes of spontaneously reported EPS-related adverse events and their severity levels rated by clinicians. Individual steady-state concentrations and occupancy levels were found to be predictors for EPS. The results confirm 80% occupancy as a level of increased EPS occurrence rates, also at the individual level.
format Online
Article
Text
id pubmed-3603470
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-36034702013-03-25 Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements Pilla Reddy, V Petersson, K J Suleiman, A A Vermeulen, A Proost, J H Friberg, L E CPT Pharmacometrics Syst Pharmacol Original Article A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred from mean plasma concentrations, have shown the incidence of EPS to rise when receptor occupancy is above ~80%. In this analysis, individual longitudinal EPS data from 2,630 patients participating in one of seven different trials and treated with haloperidol, paliperidone, ziprasidone, olanzapine, JNJ-37822681, or placebo were analyzed using a continuous time probability model with Markov elements. The developed pharmacokinetic–pharmacodynamic model describes the longitudinal changes of spontaneously reported EPS-related adverse events and their severity levels rated by clinicians. Individual steady-state concentrations and occupancy levels were found to be predictors for EPS. The results confirm 80% occupancy as a level of increased EPS occurrence rates, also at the individual level. Nature Publishing Group 2012-09 2012-09-26 /pmc/articles/PMC3603470/ /pubmed/23835881 http://dx.doi.org/10.1038/psp.2012.9 Text en Copyright © 2012 American Society for Clinical Pharmacology and Therapeutics http://creativecommons.org/licenses/by-nc-nd/3.0/ CPT: Pharmacometrics and Systems Pharmacology is an open-access journal published by Nature Publishing Group. This work is licensed under the Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-nd/3.0/
spellingShingle Original Article
Pilla Reddy, V
Petersson, K J
Suleiman, A A
Vermeulen, A
Proost, J H
Friberg, L E
Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title_full Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title_fullStr Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title_full_unstemmed Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title_short Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
title_sort pharmacokinetic–pharmacodynamic modeling of severity levels of extrapyramidal side effects with markov elements
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3603470/
https://www.ncbi.nlm.nih.gov/pubmed/23835881
http://dx.doi.org/10.1038/psp.2012.9
work_keys_str_mv AT pillareddyv pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements
AT peterssonkj pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements
AT suleimanaa pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements
AT vermeulena pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements
AT proostjh pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements
AT fribergle pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements