Cargando…
Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements
A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred f...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3603470/ https://www.ncbi.nlm.nih.gov/pubmed/23835881 http://dx.doi.org/10.1038/psp.2012.9 |
_version_ | 1782263688357478400 |
---|---|
author | Pilla Reddy, V Petersson, K J Suleiman, A A Vermeulen, A Proost, J H Friberg, L E |
author_facet | Pilla Reddy, V Petersson, K J Suleiman, A A Vermeulen, A Proost, J H Friberg, L E |
author_sort | Pilla Reddy, V |
collection | PubMed |
description | A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred from mean plasma concentrations, have shown the incidence of EPS to rise when receptor occupancy is above ~80%. In this analysis, individual longitudinal EPS data from 2,630 patients participating in one of seven different trials and treated with haloperidol, paliperidone, ziprasidone, olanzapine, JNJ-37822681, or placebo were analyzed using a continuous time probability model with Markov elements. The developed pharmacokinetic–pharmacodynamic model describes the longitudinal changes of spontaneously reported EPS-related adverse events and their severity levels rated by clinicians. Individual steady-state concentrations and occupancy levels were found to be predictors for EPS. The results confirm 80% occupancy as a level of increased EPS occurrence rates, also at the individual level. |
format | Online Article Text |
id | pubmed-3603470 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-36034702013-03-25 Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements Pilla Reddy, V Petersson, K J Suleiman, A A Vermeulen, A Proost, J H Friberg, L E CPT Pharmacometrics Syst Pharmacol Original Article A major problem in the treatment of schizophrenic patients with current antipsychotic drugs, mainly acting as dopamine-2 receptor antagonists, is the occurrence of side effects such as extrapyramidal symptoms (EPS). Meta-analyses of summary data of EPS occurrence, and receptor occupancies inferred from mean plasma concentrations, have shown the incidence of EPS to rise when receptor occupancy is above ~80%. In this analysis, individual longitudinal EPS data from 2,630 patients participating in one of seven different trials and treated with haloperidol, paliperidone, ziprasidone, olanzapine, JNJ-37822681, or placebo were analyzed using a continuous time probability model with Markov elements. The developed pharmacokinetic–pharmacodynamic model describes the longitudinal changes of spontaneously reported EPS-related adverse events and their severity levels rated by clinicians. Individual steady-state concentrations and occupancy levels were found to be predictors for EPS. The results confirm 80% occupancy as a level of increased EPS occurrence rates, also at the individual level. Nature Publishing Group 2012-09 2012-09-26 /pmc/articles/PMC3603470/ /pubmed/23835881 http://dx.doi.org/10.1038/psp.2012.9 Text en Copyright © 2012 American Society for Clinical Pharmacology and Therapeutics http://creativecommons.org/licenses/by-nc-nd/3.0/ CPT: Pharmacometrics and Systems Pharmacology is an open-access journal published by Nature Publishing Group. This work is licensed under the Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-nd/3.0/ |
spellingShingle | Original Article Pilla Reddy, V Petersson, K J Suleiman, A A Vermeulen, A Proost, J H Friberg, L E Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title | Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title_full | Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title_fullStr | Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title_full_unstemmed | Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title_short | Pharmacokinetic–Pharmacodynamic Modeling of Severity Levels of Extrapyramidal Side Effects With Markov Elements |
title_sort | pharmacokinetic–pharmacodynamic modeling of severity levels of extrapyramidal side effects with markov elements |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3603470/ https://www.ncbi.nlm.nih.gov/pubmed/23835881 http://dx.doi.org/10.1038/psp.2012.9 |
work_keys_str_mv | AT pillareddyv pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements AT peterssonkj pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements AT suleimanaa pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements AT vermeulena pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements AT proostjh pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements AT fribergle pharmacokineticpharmacodynamicmodelingofseveritylevelsofextrapyramidalsideeffectswithmarkovelements |