Cargando…

Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs

There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich en...

Descripción completa

Detalles Bibliográficos
Autores principales: van Wyngaardt, Wouter, Mashau, Cordelia, Wright, Isabel, Fehrsen, Jeanni
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Society of Veterinary Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3615239/
https://www.ncbi.nlm.nih.gov/pubmed/23388433
http://dx.doi.org/10.4142/jvs.2013.14.1.95
_version_ 1782264990167728128
author van Wyngaardt, Wouter
Mashau, Cordelia
Wright, Isabel
Fehrsen, Jeanni
author_facet van Wyngaardt, Wouter
Mashau, Cordelia
Wright, Isabel
Fehrsen, Jeanni
author_sort van Wyngaardt, Wouter
collection PubMed
description There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich enzyme-linked immunosorbent assays (DAS-ELISAs) to detect AHSV. In the DAS-ELISAs, the scFv previously selected with directly immobilized AHSV-3 functioned as a serotype-specific reagent that recognized only AHSV-3. In contrast, the one selected with AHSV-8 captured by IgG against AHSV-3 recognized all nine AHSV serotypes but not the Bryanston strain of equine encephalosis virus. Serving as evidence for its serogroup-specificity. These two scFvs can help to rapidly confirm the presence of AHSV while additional serotype-specific scFvs may simplify AHSV serotyping.
format Online
Article
Text
id pubmed-3615239
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher The Korean Society of Veterinary Science
record_format MEDLINE/PubMed
spelling pubmed-36152392013-04-08 Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs van Wyngaardt, Wouter Mashau, Cordelia Wright, Isabel Fehrsen, Jeanni J Vet Sci Short Communication There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich enzyme-linked immunosorbent assays (DAS-ELISAs) to detect AHSV. In the DAS-ELISAs, the scFv previously selected with directly immobilized AHSV-3 functioned as a serotype-specific reagent that recognized only AHSV-3. In contrast, the one selected with AHSV-8 captured by IgG against AHSV-3 recognized all nine AHSV serotypes but not the Bryanston strain of equine encephalosis virus. Serving as evidence for its serogroup-specificity. These two scFvs can help to rapidly confirm the presence of AHSV while additional serotype-specific scFvs may simplify AHSV serotyping. The Korean Society of Veterinary Science 2013-03 2013-03-24 /pmc/articles/PMC3615239/ /pubmed/23388433 http://dx.doi.org/10.4142/jvs.2013.14.1.95 Text en © 2013 The Korean Society of Veterinary Science. http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Short Communication
van Wyngaardt, Wouter
Mashau, Cordelia
Wright, Isabel
Fehrsen, Jeanni
Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title_full Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title_fullStr Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title_full_unstemmed Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title_short Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
title_sort serotype- and serogroup-specific detection of african horsesickness virus using phage displayed chicken scfvs for indirect double antibody sandwich elisas
topic Short Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3615239/
https://www.ncbi.nlm.nih.gov/pubmed/23388433
http://dx.doi.org/10.4142/jvs.2013.14.1.95
work_keys_str_mv AT vanwyngaardtwouter serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas
AT mashaucordelia serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas
AT wrightisabel serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas
AT fehrsenjeanni serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas