Cargando…
Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs
There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich en...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Society of Veterinary Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3615239/ https://www.ncbi.nlm.nih.gov/pubmed/23388433 http://dx.doi.org/10.4142/jvs.2013.14.1.95 |
_version_ | 1782264990167728128 |
---|---|
author | van Wyngaardt, Wouter Mashau, Cordelia Wright, Isabel Fehrsen, Jeanni |
author_facet | van Wyngaardt, Wouter Mashau, Cordelia Wright, Isabel Fehrsen, Jeanni |
author_sort | van Wyngaardt, Wouter |
collection | PubMed |
description | There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich enzyme-linked immunosorbent assays (DAS-ELISAs) to detect AHSV. In the DAS-ELISAs, the scFv previously selected with directly immobilized AHSV-3 functioned as a serotype-specific reagent that recognized only AHSV-3. In contrast, the one selected with AHSV-8 captured by IgG against AHSV-3 recognized all nine AHSV serotypes but not the Bryanston strain of equine encephalosis virus. Serving as evidence for its serogroup-specificity. These two scFvs can help to rapidly confirm the presence of AHSV while additional serotype-specific scFvs may simplify AHSV serotyping. |
format | Online Article Text |
id | pubmed-3615239 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | The Korean Society of Veterinary Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36152392013-04-08 Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs van Wyngaardt, Wouter Mashau, Cordelia Wright, Isabel Fehrsen, Jeanni J Vet Sci Short Communication There is an ongoing need for standardized, easily renewable immunoreagents for detecting African horsesickness virus (AHSV). Two phage displayed single-chain variable fragment (scFv) antibodies, selected from a semi-synthetic chicken antibody library, were used to develop double antibody sandwich enzyme-linked immunosorbent assays (DAS-ELISAs) to detect AHSV. In the DAS-ELISAs, the scFv previously selected with directly immobilized AHSV-3 functioned as a serotype-specific reagent that recognized only AHSV-3. In contrast, the one selected with AHSV-8 captured by IgG against AHSV-3 recognized all nine AHSV serotypes but not the Bryanston strain of equine encephalosis virus. Serving as evidence for its serogroup-specificity. These two scFvs can help to rapidly confirm the presence of AHSV while additional serotype-specific scFvs may simplify AHSV serotyping. The Korean Society of Veterinary Science 2013-03 2013-03-24 /pmc/articles/PMC3615239/ /pubmed/23388433 http://dx.doi.org/10.4142/jvs.2013.14.1.95 Text en © 2013 The Korean Society of Veterinary Science. http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Short Communication van Wyngaardt, Wouter Mashau, Cordelia Wright, Isabel Fehrsen, Jeanni Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title | Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title_full | Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title_fullStr | Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title_full_unstemmed | Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title_short | Serotype- and serogroup-specific detection of African horsesickness virus using phage displayed chicken scFvs for indirect double antibody sandwich ELISAs |
title_sort | serotype- and serogroup-specific detection of african horsesickness virus using phage displayed chicken scfvs for indirect double antibody sandwich elisas |
topic | Short Communication |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3615239/ https://www.ncbi.nlm.nih.gov/pubmed/23388433 http://dx.doi.org/10.4142/jvs.2013.14.1.95 |
work_keys_str_mv | AT vanwyngaardtwouter serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas AT mashaucordelia serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas AT wrightisabel serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas AT fehrsenjeanni serotypeandserogroupspecificdetectionofafricanhorsesicknessvirususingphagedisplayedchickenscfvsforindirectdoubleantibodysandwichelisas |