Cargando…

Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses

BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming numbe...

Descripción completa

Detalles Bibliográficos
Autores principales: van Holten, Thijs C., Waanders, Leonie F., de Groot, Philip G., Vissers, Joost, Hoefer, Imo E., Pasterkamp, Gerard, Prins, Menno W. J., Roest, Mark
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3632595/
https://www.ncbi.nlm.nih.gov/pubmed/23630624
http://dx.doi.org/10.1371/journal.pone.0062080
_version_ 1782266887725383680
author van Holten, Thijs C.
Waanders, Leonie F.
de Groot, Philip G.
Vissers, Joost
Hoefer, Imo E.
Pasterkamp, Gerard
Prins, Menno W. J.
Roest, Mark
author_facet van Holten, Thijs C.
Waanders, Leonie F.
de Groot, Philip G.
Vissers, Joost
Hoefer, Imo E.
Pasterkamp, Gerard
Prins, Menno W. J.
Roest, Mark
author_sort van Holten, Thijs C.
collection PubMed
description BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming number of studies and meta-analyses on biomarkers and cardiovascular disease, there are no comprehensive studies comparing the relevance of each biomarker. We performed a systematic review of meta-analyses on levels of serological biomarkers for atherothrombosis to compare the relevance of the most commonly studied biomarkers. METHODS AND FINDINGS: Medline and Embase were screened on search terms that were related to “arterial ischemic events” and “meta-analyses”. The meta-analyses were sorted by patient groups without pre-existing cardiovascular disease, with cardiovascular disease and heterogeneous groups concerning general populations, groups with and without cardiovascular disease, or miscellaneous. These were subsequently sorted by end-point for cardiovascular disease or stroke and summarized in tables. We have identified 85 relevant full text articles, with 214 meta-analyses. Markers for primary cardiovascular events include, from high to low result: C-reactive protein, fibrinogen, cholesterol, apolipoprotein B, the apolipoprotein A/apolipoprotein B ratio, high density lipoprotein, and vitamin D. Markers for secondary cardiovascular events include, from high to low result: cardiac troponins I and T, C-reactive protein, serum creatinine, and cystatin C. For primary stroke, fibrinogen and serum uric acid are strong risk markers. Limitations reside in that there is no acknowledged search strategy for prognostic studies or meta-analyses. CONCLUSIONS: For primary cardiovascular events, markers with strong predictive potential are mainly associated with lipids. For secondary cardiovascular events, markers are more associated with ischemia. Fibrinogen is a strong predictor for primary stroke.
format Online
Article
Text
id pubmed-3632595
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-36325952013-04-29 Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses van Holten, Thijs C. Waanders, Leonie F. de Groot, Philip G. Vissers, Joost Hoefer, Imo E. Pasterkamp, Gerard Prins, Menno W. J. Roest, Mark PLoS One Research Article BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming number of studies and meta-analyses on biomarkers and cardiovascular disease, there are no comprehensive studies comparing the relevance of each biomarker. We performed a systematic review of meta-analyses on levels of serological biomarkers for atherothrombosis to compare the relevance of the most commonly studied biomarkers. METHODS AND FINDINGS: Medline and Embase were screened on search terms that were related to “arterial ischemic events” and “meta-analyses”. The meta-analyses were sorted by patient groups without pre-existing cardiovascular disease, with cardiovascular disease and heterogeneous groups concerning general populations, groups with and without cardiovascular disease, or miscellaneous. These were subsequently sorted by end-point for cardiovascular disease or stroke and summarized in tables. We have identified 85 relevant full text articles, with 214 meta-analyses. Markers for primary cardiovascular events include, from high to low result: C-reactive protein, fibrinogen, cholesterol, apolipoprotein B, the apolipoprotein A/apolipoprotein B ratio, high density lipoprotein, and vitamin D. Markers for secondary cardiovascular events include, from high to low result: cardiac troponins I and T, C-reactive protein, serum creatinine, and cystatin C. For primary stroke, fibrinogen and serum uric acid are strong risk markers. Limitations reside in that there is no acknowledged search strategy for prognostic studies or meta-analyses. CONCLUSIONS: For primary cardiovascular events, markers with strong predictive potential are mainly associated with lipids. For secondary cardiovascular events, markers are more associated with ischemia. Fibrinogen is a strong predictor for primary stroke. Public Library of Science 2013-04-22 /pmc/articles/PMC3632595/ /pubmed/23630624 http://dx.doi.org/10.1371/journal.pone.0062080 Text en © 2013 van Holten et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
van Holten, Thijs C.
Waanders, Leonie F.
de Groot, Philip G.
Vissers, Joost
Hoefer, Imo E.
Pasterkamp, Gerard
Prins, Menno W. J.
Roest, Mark
Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title_full Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title_fullStr Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title_full_unstemmed Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title_short Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
title_sort circulating biomarkers for predicting cardiovascular disease risk; a systematic review and comprehensive overview of meta-analyses
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3632595/
https://www.ncbi.nlm.nih.gov/pubmed/23630624
http://dx.doi.org/10.1371/journal.pone.0062080
work_keys_str_mv AT vanholtenthijsc circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT waandersleonief circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT degrootphilipg circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT vissersjoost circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT hoeferimoe circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT pasterkampgerard circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT prinsmennowj circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses
AT roestmark circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses