Cargando…
Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses
BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming numbe...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3632595/ https://www.ncbi.nlm.nih.gov/pubmed/23630624 http://dx.doi.org/10.1371/journal.pone.0062080 |
_version_ | 1782266887725383680 |
---|---|
author | van Holten, Thijs C. Waanders, Leonie F. de Groot, Philip G. Vissers, Joost Hoefer, Imo E. Pasterkamp, Gerard Prins, Menno W. J. Roest, Mark |
author_facet | van Holten, Thijs C. Waanders, Leonie F. de Groot, Philip G. Vissers, Joost Hoefer, Imo E. Pasterkamp, Gerard Prins, Menno W. J. Roest, Mark |
author_sort | van Holten, Thijs C. |
collection | PubMed |
description | BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming number of studies and meta-analyses on biomarkers and cardiovascular disease, there are no comprehensive studies comparing the relevance of each biomarker. We performed a systematic review of meta-analyses on levels of serological biomarkers for atherothrombosis to compare the relevance of the most commonly studied biomarkers. METHODS AND FINDINGS: Medline and Embase were screened on search terms that were related to “arterial ischemic events” and “meta-analyses”. The meta-analyses were sorted by patient groups without pre-existing cardiovascular disease, with cardiovascular disease and heterogeneous groups concerning general populations, groups with and without cardiovascular disease, or miscellaneous. These were subsequently sorted by end-point for cardiovascular disease or stroke and summarized in tables. We have identified 85 relevant full text articles, with 214 meta-analyses. Markers for primary cardiovascular events include, from high to low result: C-reactive protein, fibrinogen, cholesterol, apolipoprotein B, the apolipoprotein A/apolipoprotein B ratio, high density lipoprotein, and vitamin D. Markers for secondary cardiovascular events include, from high to low result: cardiac troponins I and T, C-reactive protein, serum creatinine, and cystatin C. For primary stroke, fibrinogen and serum uric acid are strong risk markers. Limitations reside in that there is no acknowledged search strategy for prognostic studies or meta-analyses. CONCLUSIONS: For primary cardiovascular events, markers with strong predictive potential are mainly associated with lipids. For secondary cardiovascular events, markers are more associated with ischemia. Fibrinogen is a strong predictor for primary stroke. |
format | Online Article Text |
id | pubmed-3632595 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36325952013-04-29 Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses van Holten, Thijs C. Waanders, Leonie F. de Groot, Philip G. Vissers, Joost Hoefer, Imo E. Pasterkamp, Gerard Prins, Menno W. J. Roest, Mark PLoS One Research Article BACKGROUND: Cardiovascular disease is one of the major causes of death worldwide. Assessing the risk for cardiovascular disease is an important aspect in clinical decision making and setting a therapeutic strategy, and the use of serological biomarkers may improve this. Despite an overwhelming number of studies and meta-analyses on biomarkers and cardiovascular disease, there are no comprehensive studies comparing the relevance of each biomarker. We performed a systematic review of meta-analyses on levels of serological biomarkers for atherothrombosis to compare the relevance of the most commonly studied biomarkers. METHODS AND FINDINGS: Medline and Embase were screened on search terms that were related to “arterial ischemic events” and “meta-analyses”. The meta-analyses were sorted by patient groups without pre-existing cardiovascular disease, with cardiovascular disease and heterogeneous groups concerning general populations, groups with and without cardiovascular disease, or miscellaneous. These were subsequently sorted by end-point for cardiovascular disease or stroke and summarized in tables. We have identified 85 relevant full text articles, with 214 meta-analyses. Markers for primary cardiovascular events include, from high to low result: C-reactive protein, fibrinogen, cholesterol, apolipoprotein B, the apolipoprotein A/apolipoprotein B ratio, high density lipoprotein, and vitamin D. Markers for secondary cardiovascular events include, from high to low result: cardiac troponins I and T, C-reactive protein, serum creatinine, and cystatin C. For primary stroke, fibrinogen and serum uric acid are strong risk markers. Limitations reside in that there is no acknowledged search strategy for prognostic studies or meta-analyses. CONCLUSIONS: For primary cardiovascular events, markers with strong predictive potential are mainly associated with lipids. For secondary cardiovascular events, markers are more associated with ischemia. Fibrinogen is a strong predictor for primary stroke. Public Library of Science 2013-04-22 /pmc/articles/PMC3632595/ /pubmed/23630624 http://dx.doi.org/10.1371/journal.pone.0062080 Text en © 2013 van Holten et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article van Holten, Thijs C. Waanders, Leonie F. de Groot, Philip G. Vissers, Joost Hoefer, Imo E. Pasterkamp, Gerard Prins, Menno W. J. Roest, Mark Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title | Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title_full | Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title_fullStr | Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title_full_unstemmed | Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title_short | Circulating Biomarkers for Predicting Cardiovascular Disease Risk; a Systematic Review and Comprehensive Overview of Meta-Analyses |
title_sort | circulating biomarkers for predicting cardiovascular disease risk; a systematic review and comprehensive overview of meta-analyses |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3632595/ https://www.ncbi.nlm.nih.gov/pubmed/23630624 http://dx.doi.org/10.1371/journal.pone.0062080 |
work_keys_str_mv | AT vanholtenthijsc circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT waandersleonief circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT degrootphilipg circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT vissersjoost circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT hoeferimoe circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT pasterkampgerard circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT prinsmennowj circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses AT roestmark circulatingbiomarkersforpredictingcardiovasculardiseaseriskasystematicreviewandcomprehensiveoverviewofmetaanalyses |