Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China

Goose/GD/2010 is a newly emerging Newcastle disease virus (NDV) isolated from a sick goose flock in southern China. Here, we report the complete genome sequence of this isolate, which belongs to NDV subgenotype VIIb. This is the first report about the complete genome information of an isolate of sub...

Descripción completa

Detalles Bibliográficos
Autores principales: Sun, Minhua, Dong, Jiawen, Wang, Zhaoxiong, Li, Linlin, Yuan, Jianfeng, Jiao, Peirong, Hu, Qilin, Ren, Tao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2013
Materias:
Viruses
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3650432/
https://www.ncbi.nlm.nih.gov/pubmed/23661473
http://dx.doi.org/10.1128/genomeA.00169-13
_version_ 1782269088454672384
author Sun, Minhua
Dong, Jiawen
Wang, Zhaoxiong
Li, Linlin
Yuan, Jianfeng
Jiao, Peirong
Hu, Qilin
Ren, Tao
author_facet Sun, Minhua
Dong, Jiawen
Wang, Zhaoxiong
Li, Linlin
Yuan, Jianfeng
Jiao, Peirong
Hu, Qilin
Ren, Tao
author_sort Sun, Minhua
collection PubMed
description Goose/GD/2010 is a newly emerging Newcastle disease virus (NDV) isolated from a sick goose flock in southern China. Here, we report the complete genome sequence of this isolate, which belongs to NDV subgenotype VIIb. This is the first report about the complete genome information of an isolate of subgenotype VIIb in China.
format Online
Article
Text
id pubmed-3650432
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-36504322013-05-14 Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China Sun, Minhua Dong, Jiawen Wang, Zhaoxiong Li, Linlin Yuan, Jianfeng Jiao, Peirong Hu, Qilin Ren, Tao Genome Announc Viruses Goose/GD/2010 is a newly emerging Newcastle disease virus (NDV) isolated from a sick goose flock in southern China. Here, we report the complete genome sequence of this isolate, which belongs to NDV subgenotype VIIb. This is the first report about the complete genome information of an isolate of subgenotype VIIb in China. American Society for Microbiology 2013-05-09 /pmc/articles/PMC3650432/ /pubmed/23661473 http://dx.doi.org/10.1128/genomeA.00169-13 Text en Copyright © 2013 Sun et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 3.0 Unported license (http://creativecommons.org/licenses/by/3.0/) .
spellingShingle Viruses
Sun, Minhua
Dong, Jiawen
Wang, Zhaoxiong
Li, Linlin
Yuan, Jianfeng
Jiao, Peirong
Hu, Qilin
Ren, Tao
Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title_full Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title_fullStr Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title_full_unstemmed Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title_short Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Isolated in China
title_sort complete genome sequence of a newly emerging newcastle disease virus isolated in china
topic Viruses
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3650432/
https://www.ncbi.nlm.nih.gov/pubmed/23661473
http://dx.doi.org/10.1128/genomeA.00169-13
work_keys_str_mv AT sunminhua completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT dongjiawen completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT wangzhaoxiong completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT lilinlin completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT yuanjianfeng completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT jiaopeirong completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT huqilin completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina
AT rentao completegenomesequenceofanewlyemergingnewcastlediseasevirusisolatedinchina

Ejemplares similares