Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus

The complete genome sequence of a newly emerging Newcastle disease virus, isolated in China, was determined. A phylogenetic analysis based on the F gene revealed that the isolate is phylogenetically related to Newcastle disease virus genotype VIId. Sequence analysis indicated that amino acid residue...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Jing-Yu, Liu, Wan-Hua, Ren, Juan-Juan, Tang, Pan, Wu, Ning, Liu, Hung-Jen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2013
Materias:
Viruses
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3650438/
https://www.ncbi.nlm.nih.gov/pubmed/23661479
http://dx.doi.org/10.1128/genomeA.00196-13
_version_ 1782269089844035584
author Wang, Jing-Yu
Liu, Wan-Hua
Ren, Juan-Juan
Tang, Pan
Wu, Ning
Liu, Hung-Jen
author_facet Wang, Jing-Yu
Liu, Wan-Hua
Ren, Juan-Juan
Tang, Pan
Wu, Ning
Liu, Hung-Jen
author_sort Wang, Jing-Yu
collection PubMed
description The complete genome sequence of a newly emerging Newcastle disease virus, isolated in China, was determined. A phylogenetic analysis based on the F gene revealed that the isolate is phylogenetically related to Newcastle disease virus genotype VIId. Sequence analysis indicated that amino acid residue substitutions occur at neutralizing epitopes on the hemagglutinin-neuraminidase (HN) protein.
format Online
Article
Text
id pubmed-3650438
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-36504382013-05-14 Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus Wang, Jing-Yu Liu, Wan-Hua Ren, Juan-Juan Tang, Pan Wu, Ning Liu, Hung-Jen Genome Announc Viruses The complete genome sequence of a newly emerging Newcastle disease virus, isolated in China, was determined. A phylogenetic analysis based on the F gene revealed that the isolate is phylogenetically related to Newcastle disease virus genotype VIId. Sequence analysis indicated that amino acid residue substitutions occur at neutralizing epitopes on the hemagglutinin-neuraminidase (HN) protein. American Society for Microbiology 2013-05-09 /pmc/articles/PMC3650438/ /pubmed/23661479 http://dx.doi.org/10.1128/genomeA.00196-13 Text en Copyright © 2013 Wang et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 3.0 Unported license (http://creativecommons.org/licenses/by/3.0/) .
spellingShingle Viruses
Wang, Jing-Yu
Liu, Wan-Hua
Ren, Juan-Juan
Tang, Pan
Wu, Ning
Liu, Hung-Jen
Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title_full Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title_fullStr Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title_full_unstemmed Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title_short Complete Genome Sequence of a Newly Emerging Newcastle Disease Virus
title_sort complete genome sequence of a newly emerging newcastle disease virus
topic Viruses
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3650438/
https://www.ncbi.nlm.nih.gov/pubmed/23661479
http://dx.doi.org/10.1128/genomeA.00196-13
work_keys_str_mv AT wangjingyu completegenomesequenceofanewlyemergingnewcastlediseasevirus
AT liuwanhua completegenomesequenceofanewlyemergingnewcastlediseasevirus
AT renjuanjuan completegenomesequenceofanewlyemergingnewcastlediseasevirus
AT tangpan completegenomesequenceofanewlyemergingnewcastlediseasevirus
AT wuning completegenomesequenceofanewlyemergingnewcastlediseasevirus
AT liuhungjen completegenomesequenceofanewlyemergingnewcastlediseasevirus

Ejemplares similares