Cargando…

New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report

OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in tur...

Descripción completa

Detalles Bibliográficos
Autores principales: Galehdari, Hamid, Tangestani, Raheleh, Ghasemian, Sepideh
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Tehran University of Medical Sciences 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663321/
https://www.ncbi.nlm.nih.gov/pubmed/23724191
_version_ 1782270972020129792
author Galehdari, Hamid
Tangestani, Raheleh
Ghasemian, Sepideh
author_facet Galehdari, Hamid
Tangestani, Raheleh
Ghasemian, Sepideh
author_sort Galehdari, Hamid
collection PubMed
description OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in turn causes dysfunction or damage of tissue. METHODS: We report firstly a 2.5 year old boy with NPA in southwest Iran. Initially, the diagnosis was resulted on the basis of clinical symptoms. The genomic DNA of the suspected individual was subjected to exon sequencing of the SMPD1 gene. According to the human reference sequence NM_000543.4, a novel single guanine deletion resulting in a frameshift mutation (p.Gly247Alafs*9) was observed in the SMPD1 gene that might be causative for the outcome of the disease. FINDINGS: The present report is the first molecular genetics diagnosis of the NPA in southwest Iran. The detected deletion in the SMPD1 gene is remarkable because of its novelty. CONCLUSION: Despite similar morbidity SGA infants exhibited higher lethal complication rates following delayed meconium passage compared to AGA infants.
format Online
Article
Text
id pubmed-3663321
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Tehran University of Medical Sciences
record_format MEDLINE/PubMed
spelling pubmed-36633212013-05-30 New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report Galehdari, Hamid Tangestani, Raheleh Ghasemian, Sepideh Iran J Pediatr Original Article OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in turn causes dysfunction or damage of tissue. METHODS: We report firstly a 2.5 year old boy with NPA in southwest Iran. Initially, the diagnosis was resulted on the basis of clinical symptoms. The genomic DNA of the suspected individual was subjected to exon sequencing of the SMPD1 gene. According to the human reference sequence NM_000543.4, a novel single guanine deletion resulting in a frameshift mutation (p.Gly247Alafs*9) was observed in the SMPD1 gene that might be causative for the outcome of the disease. FINDINGS: The present report is the first molecular genetics diagnosis of the NPA in southwest Iran. The detected deletion in the SMPD1 gene is remarkable because of its novelty. CONCLUSION: Despite similar morbidity SGA infants exhibited higher lethal complication rates following delayed meconium passage compared to AGA infants. Tehran University of Medical Sciences 2013-04 /pmc/articles/PMC3663321/ /pubmed/23724191 Text en © 2013 Iranian Journal of Pediatrics & Tehran University of Medical Sciences http://creativecommons.org/licenses/by-nc/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution NonCommercial 3.0 License (CC BY-NC 3.0), which allows users to read, copy, distribute and make derivative works for non-commercial purposes from the material, as long as the author of the original work is cited properly.
spellingShingle Original Article
Galehdari, Hamid
Tangestani, Raheleh
Ghasemian, Sepideh
New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title_full New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title_fullStr New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title_full_unstemmed New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title_short New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
title_sort new single nucleotide deletion in the smpd1 gene causes niemann pick disease type a in a child from southwest iran: a case report
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663321/
https://www.ncbi.nlm.nih.gov/pubmed/23724191
work_keys_str_mv AT galehdarihamid newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport
AT tangestaniraheleh newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport
AT ghasemiansepideh newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport