Cargando…
New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report
OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in tur...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Tehran University of Medical Sciences
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663321/ https://www.ncbi.nlm.nih.gov/pubmed/23724191 |
_version_ | 1782270972020129792 |
---|---|
author | Galehdari, Hamid Tangestani, Raheleh Ghasemian, Sepideh |
author_facet | Galehdari, Hamid Tangestani, Raheleh Ghasemian, Sepideh |
author_sort | Galehdari, Hamid |
collection | PubMed |
description | OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in turn causes dysfunction or damage of tissue. METHODS: We report firstly a 2.5 year old boy with NPA in southwest Iran. Initially, the diagnosis was resulted on the basis of clinical symptoms. The genomic DNA of the suspected individual was subjected to exon sequencing of the SMPD1 gene. According to the human reference sequence NM_000543.4, a novel single guanine deletion resulting in a frameshift mutation (p.Gly247Alafs*9) was observed in the SMPD1 gene that might be causative for the outcome of the disease. FINDINGS: The present report is the first molecular genetics diagnosis of the NPA in southwest Iran. The detected deletion in the SMPD1 gene is remarkable because of its novelty. CONCLUSION: Despite similar morbidity SGA infants exhibited higher lethal complication rates following delayed meconium passage compared to AGA infants. |
format | Online Article Text |
id | pubmed-3663321 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Tehran University of Medical Sciences |
record_format | MEDLINE/PubMed |
spelling | pubmed-36633212013-05-30 New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report Galehdari, Hamid Tangestani, Raheleh Ghasemian, Sepideh Iran J Pediatr Original Article OBJECTIVE: Niemann Pick disease (NPD) type A (NPA: MIM #257200) is a lipid storage disorder with an autosomal recessive inheritance and occurrs by defect of the SMPD1 gene encoding sphingomyelinase. Disruption of this enzyme leads to the accumulation of sphingomyelin in brain and liver, which in turn causes dysfunction or damage of tissue. METHODS: We report firstly a 2.5 year old boy with NPA in southwest Iran. Initially, the diagnosis was resulted on the basis of clinical symptoms. The genomic DNA of the suspected individual was subjected to exon sequencing of the SMPD1 gene. According to the human reference sequence NM_000543.4, a novel single guanine deletion resulting in a frameshift mutation (p.Gly247Alafs*9) was observed in the SMPD1 gene that might be causative for the outcome of the disease. FINDINGS: The present report is the first molecular genetics diagnosis of the NPA in southwest Iran. The detected deletion in the SMPD1 gene is remarkable because of its novelty. CONCLUSION: Despite similar morbidity SGA infants exhibited higher lethal complication rates following delayed meconium passage compared to AGA infants. Tehran University of Medical Sciences 2013-04 /pmc/articles/PMC3663321/ /pubmed/23724191 Text en © 2013 Iranian Journal of Pediatrics & Tehran University of Medical Sciences http://creativecommons.org/licenses/by-nc/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution NonCommercial 3.0 License (CC BY-NC 3.0), which allows users to read, copy, distribute and make derivative works for non-commercial purposes from the material, as long as the author of the original work is cited properly. |
spellingShingle | Original Article Galehdari, Hamid Tangestani, Raheleh Ghasemian, Sepideh New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title | New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title_full | New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title_fullStr | New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title_full_unstemmed | New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title_short | New Single Nucleotide Deletion In the SMPD1 Gene Causes Niemann Pick Disease Type A in a Child from Southwest Iran: A Case Report |
title_sort | new single nucleotide deletion in the smpd1 gene causes niemann pick disease type a in a child from southwest iran: a case report |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663321/ https://www.ncbi.nlm.nih.gov/pubmed/23724191 |
work_keys_str_mv | AT galehdarihamid newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport AT tangestaniraheleh newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport AT ghasemiansepideh newsinglenucleotidedeletioninthesmpd1genecausesniemannpickdiseasetypeainachildfromsouthwestiranacasereport |