Cargando…

Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2

BACKGROUND: Hermansky-Pudlak syndrome 2 (HPS2; OMIM #608233) is a rare, autosomal recessive disorder caused by loss-of-function genetic variations affecting AP3B1, which encodes the β3A subunit of the adaptor-related protein complex 3 (AP3). Phenotypic characteristics include reduced pigmentation, a...

Descripción completa

Detalles Bibliográficos
Autores principales: Jones, Matthew L, Murden, Sherina L, Brooks, Claire, Maloney, Viv, Manning, Richard A, Gilmour, Kimberly C, Bharadwaj, Vandana, de la Fuente, Josu, Chakravorty, Subarna, Mumford, Andrew D
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663694/
https://www.ncbi.nlm.nih.gov/pubmed/23557002
http://dx.doi.org/10.1186/1471-2350-14-42
_version_ 1782271021161644032
author Jones, Matthew L
Murden, Sherina L
Brooks, Claire
Maloney, Viv
Manning, Richard A
Gilmour, Kimberly C
Bharadwaj, Vandana
de la Fuente, Josu
Chakravorty, Subarna
Mumford, Andrew D
author_facet Jones, Matthew L
Murden, Sherina L
Brooks, Claire
Maloney, Viv
Manning, Richard A
Gilmour, Kimberly C
Bharadwaj, Vandana
de la Fuente, Josu
Chakravorty, Subarna
Mumford, Andrew D
author_sort Jones, Matthew L
collection PubMed
description BACKGROUND: Hermansky-Pudlak syndrome 2 (HPS2; OMIM #608233) is a rare, autosomal recessive disorder caused by loss-of-function genetic variations affecting AP3B1, which encodes the β3A subunit of the adaptor-related protein complex 3 (AP3). Phenotypic characteristics include reduced pigmentation, absent platelet dense granule secretion, neutropenia and reduced cytotoxic T lymphocyte (CTL) and natural killer (NK) cell function. To date HPS2 has been associated with non-synonymous, stop-gain or deletion-insertion nucleotide variations within the coding region of AP3B1. CASE PRESENTATION: We describe a consanguineous female infant with reduced pigmentation, neutropenia and recurrent infections. Platelets displayed reduced aggregation and absent ATP secretion in response to collagen and ADP, indicating a platelet dense granule defect. There was increased basal surface expression of CD107a (lysosome-associated membrane protein 1(LAMP-1)) on NK cells and CTLs from the study subject and a smaller increase in the percentage of CD107a positive cells after stimulation compared to most healthy controls. Immunoblotting of protein extracts from EBV-transformed lymphoblasts from the index case showed absent expression of full-length AP-3 β3A subunit protein, confirming a phenotypic diagnosis of HPS2. The index case displayed a homozygous pericentric inv(5)(p15.1q14.1), which was also detected as a heterozygous defect in both parents of the index case. No loss of genetic material was demonstrated by microarray comparative genome hybridisation at 60kb resolution. Fluorescence in-situ hybridisation using the 189.6kb probe RP11-422I12, which maps to 5q14.1, demonstrated dual hybridisation to both 5q14.1 and 5p15.1 regions of the inverted Chr5. The RP11-422I12 probe maps from intron 1 to intron 16 of AP3B1, thus localising the 5q inversion breakpoint to within AP3B1. The probe RP11-211K15, which corresponds to an intergenic region on 5p also showed dual hybridisation, enabling localisation of the 5p inversion breakpoint. CONCLUSION: This case report extends the phenotypic description of the very rare disorder HPS2. Our demonstration of a homozygous Chr5 inversion predicted to disrupt AP3B1 gene provides a novel pathogenic mechanism for this disorder.
format Online
Article
Text
id pubmed-3663694
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-36636942013-05-25 Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2 Jones, Matthew L Murden, Sherina L Brooks, Claire Maloney, Viv Manning, Richard A Gilmour, Kimberly C Bharadwaj, Vandana de la Fuente, Josu Chakravorty, Subarna Mumford, Andrew D BMC Med Genet Case Report BACKGROUND: Hermansky-Pudlak syndrome 2 (HPS2; OMIM #608233) is a rare, autosomal recessive disorder caused by loss-of-function genetic variations affecting AP3B1, which encodes the β3A subunit of the adaptor-related protein complex 3 (AP3). Phenotypic characteristics include reduced pigmentation, absent platelet dense granule secretion, neutropenia and reduced cytotoxic T lymphocyte (CTL) and natural killer (NK) cell function. To date HPS2 has been associated with non-synonymous, stop-gain or deletion-insertion nucleotide variations within the coding region of AP3B1. CASE PRESENTATION: We describe a consanguineous female infant with reduced pigmentation, neutropenia and recurrent infections. Platelets displayed reduced aggregation and absent ATP secretion in response to collagen and ADP, indicating a platelet dense granule defect. There was increased basal surface expression of CD107a (lysosome-associated membrane protein 1(LAMP-1)) on NK cells and CTLs from the study subject and a smaller increase in the percentage of CD107a positive cells after stimulation compared to most healthy controls. Immunoblotting of protein extracts from EBV-transformed lymphoblasts from the index case showed absent expression of full-length AP-3 β3A subunit protein, confirming a phenotypic diagnosis of HPS2. The index case displayed a homozygous pericentric inv(5)(p15.1q14.1), which was also detected as a heterozygous defect in both parents of the index case. No loss of genetic material was demonstrated by microarray comparative genome hybridisation at 60kb resolution. Fluorescence in-situ hybridisation using the 189.6kb probe RP11-422I12, which maps to 5q14.1, demonstrated dual hybridisation to both 5q14.1 and 5p15.1 regions of the inverted Chr5. The RP11-422I12 probe maps from intron 1 to intron 16 of AP3B1, thus localising the 5q inversion breakpoint to within AP3B1. The probe RP11-211K15, which corresponds to an intergenic region on 5p also showed dual hybridisation, enabling localisation of the 5p inversion breakpoint. CONCLUSION: This case report extends the phenotypic description of the very rare disorder HPS2. Our demonstration of a homozygous Chr5 inversion predicted to disrupt AP3B1 gene provides a novel pathogenic mechanism for this disorder. BioMed Central 2013-04-04 /pmc/articles/PMC3663694/ /pubmed/23557002 http://dx.doi.org/10.1186/1471-2350-14-42 Text en Copyright © 2013 Jones et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Case Report
Jones, Matthew L
Murden, Sherina L
Brooks, Claire
Maloney, Viv
Manning, Richard A
Gilmour, Kimberly C
Bharadwaj, Vandana
de la Fuente, Josu
Chakravorty, Subarna
Mumford, Andrew D
Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title_full Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title_fullStr Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title_full_unstemmed Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title_short Disruption of AP3B1 by a chromosome 5 inversion: a new disease mechanism in Hermansky-Pudlak syndrome type 2
title_sort disruption of ap3b1 by a chromosome 5 inversion: a new disease mechanism in hermansky-pudlak syndrome type 2
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3663694/
https://www.ncbi.nlm.nih.gov/pubmed/23557002
http://dx.doi.org/10.1186/1471-2350-14-42
work_keys_str_mv AT jonesmatthewl disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT murdensherinal disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT brooksclaire disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT maloneyviv disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT manningricharda disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT gilmourkimberlyc disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT bharadwajvandana disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT delafuentejosu disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT chakravortysubarna disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2
AT mumfordandrewd disruptionofap3b1byachromosome5inversionanewdiseasemechanisminhermanskypudlaksyndrometype2