Cargando…

Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners

PURPOSE: Walking is purported to reduce the risk of atrial fibrillation by 48%, whereas jogging is purported to increase its risk by 53%, suggesting a strong anti-arrhythmic benefit of walking over running. The purpose of these analyses is to compare incident self-reported physician-diagnosed cardia...

Descripción completa

Detalles Bibliográficos
Autores principales: Williams, Paul T., Franklin, Barry A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676466/
https://www.ncbi.nlm.nih.gov/pubmed/23762337
http://dx.doi.org/10.1371/journal.pone.0065302
_version_ 1782272642916548608
author Williams, Paul T.
Franklin, Barry A.
author_facet Williams, Paul T.
Franklin, Barry A.
author_sort Williams, Paul T.
collection PubMed
description PURPOSE: Walking is purported to reduce the risk of atrial fibrillation by 48%, whereas jogging is purported to increase its risk by 53%, suggesting a strong anti-arrhythmic benefit of walking over running. The purpose of these analyses is to compare incident self-reported physician-diagnosed cardiac arrhythmia to baseline energy expenditure (metabolic equivalent hours per day, METhr/d) from walking, running and other exercise. METHODS: Proportional hazards analysis of 14,734 walkers and 32,073 runners. RESULTS: There were 1,060 incident cardiac arrhythmias (412 walkers, 648 runners) during 6.2 years of follow-up. The risk for incident cardiac arrhythmias declined 4.4% per baseline METhr/d walked by the walkers, or running in the runners (P = 0.0001). Specifically, the risk declined 14.2% (hazard ratio: 0.858) for 1.8 to 3.6 METhr/d, 26.5% for 3.6 to 5.4 METhr/d, and 31.7% for ≥5.4 METhr/d, relative to <1.8 METhr/d. The risk reduction per METhr/d was significantly greater for walking than running (P<0.01), but only because walkers were at 34% greater risk than runners who fell below contemporary physical activity guideline recommendations; otherwise the walkers and runners had similar risks for cardiac arrhythmias. Cardiac arrhythmias were unrelated to walking and running intensity, and unrelated to marathon participation and performance. CONCLUSIONS: The risk for cardiac arrhythmias was similar in walkers and runners who expended comparable METhr/d during structured exercise. We found no significant risk increase for self-reported cardiac arrhythmias associated with running distance, exercise intensity, or marathon participation. Rhythm abnormalities were based on self-report, precluding definitive categorization of the nature of the rhythm disturbance. However, even if the runners’ arrhythmias include sinus bradycardia due to running itself, there was no increase in arrhythmias with greater running distance.
format Online
Article
Text
id pubmed-3676466
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-36764662013-06-12 Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners Williams, Paul T. Franklin, Barry A. PLoS One Research Article PURPOSE: Walking is purported to reduce the risk of atrial fibrillation by 48%, whereas jogging is purported to increase its risk by 53%, suggesting a strong anti-arrhythmic benefit of walking over running. The purpose of these analyses is to compare incident self-reported physician-diagnosed cardiac arrhythmia to baseline energy expenditure (metabolic equivalent hours per day, METhr/d) from walking, running and other exercise. METHODS: Proportional hazards analysis of 14,734 walkers and 32,073 runners. RESULTS: There were 1,060 incident cardiac arrhythmias (412 walkers, 648 runners) during 6.2 years of follow-up. The risk for incident cardiac arrhythmias declined 4.4% per baseline METhr/d walked by the walkers, or running in the runners (P = 0.0001). Specifically, the risk declined 14.2% (hazard ratio: 0.858) for 1.8 to 3.6 METhr/d, 26.5% for 3.6 to 5.4 METhr/d, and 31.7% for ≥5.4 METhr/d, relative to <1.8 METhr/d. The risk reduction per METhr/d was significantly greater for walking than running (P<0.01), but only because walkers were at 34% greater risk than runners who fell below contemporary physical activity guideline recommendations; otherwise the walkers and runners had similar risks for cardiac arrhythmias. Cardiac arrhythmias were unrelated to walking and running intensity, and unrelated to marathon participation and performance. CONCLUSIONS: The risk for cardiac arrhythmias was similar in walkers and runners who expended comparable METhr/d during structured exercise. We found no significant risk increase for self-reported cardiac arrhythmias associated with running distance, exercise intensity, or marathon participation. Rhythm abnormalities were based on self-report, precluding definitive categorization of the nature of the rhythm disturbance. However, even if the runners’ arrhythmias include sinus bradycardia due to running itself, there was no increase in arrhythmias with greater running distance. Public Library of Science 2013-06-07 /pmc/articles/PMC3676466/ /pubmed/23762337 http://dx.doi.org/10.1371/journal.pone.0065302 Text en https://creativecommons.org/publicdomain/zero/1.0/ This is an open-access article distributed under the terms of the Creative Commons Public Domain declaration, which stipulates that, once placed in the public domain, this work may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose.
spellingShingle Research Article
Williams, Paul T.
Franklin, Barry A.
Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title_full Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title_fullStr Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title_full_unstemmed Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title_short Reduced Incidence of Cardiac Arrhythmias in Walkers and Runners
title_sort reduced incidence of cardiac arrhythmias in walkers and runners
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3676466/
https://www.ncbi.nlm.nih.gov/pubmed/23762337
http://dx.doi.org/10.1371/journal.pone.0065302
work_keys_str_mv AT williamspault reducedincidenceofcardiacarrhythmiasinwalkersandrunners
AT franklinbarrya reducedincidenceofcardiacarrhythmiasinwalkersandrunners