Cargando…
Selaginella tamariscina Attenuates Metastasis via Akt Pathways in Oral Cancer Cells
BACKGROUND: Crude extracts of Selaginella tamariscina , an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginella tamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODO...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3683067/ https://www.ncbi.nlm.nih.gov/pubmed/23799155 http://dx.doi.org/10.1371/journal.pone.0068035 |
_version_ | 1782273453893615616 |
---|---|
author | Yang, Jia-Sin Lin, Chiao-Wen Hsin, Chung-Han Hsieh, Ming-Ju Chang, Yu-Chao |
author_facet | Yang, Jia-Sin Lin, Chiao-Wen Hsin, Chung-Han Hsieh, Ming-Ju Chang, Yu-Chao |
author_sort | Yang, Jia-Sin |
collection | PubMed |
description | BACKGROUND: Crude extracts of Selaginella tamariscina , an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginella tamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODOLOGY/PRINCIPAL FINDINGS: Herein, we demonstrate that Selaginella tamariscina attenuated HSC-3 cell migration and invasion in a dose-dependent manner. The anti-metastatic activities of Selaginella tamariscina occurred at least partially because of the down-regulation of matrix metalloproteinases (MMP)-2 and MMP-9 gelatinase activity and the down-regulation of protein expression. The expression and function of both MMP-2 and MMP-9 were regulated by Selaginella tamariscina at a transcriptional level, as shown by quantitative real-time PCR and reporter assays. Chromatin immunoprecipitation (ChIP) data further indicated that binding of the cAMP response element-binding (CREB) protein and activating protein-1 (AP-1) to the MMP-2 promoter diminished at the highest dosage level of Selaginella tamariscina . The DNA-binding activity of specificity protein 1 (SP-1) to the MMP-9 promoter was also suppressed at the same concentration. Selaginella tamariscina did not affect the mitogen-activated protein kinase signaling pathway, but did inhibit the effects of gelatinase by reducing the activation of serine–threonine kinase Akt. CONCLUSIONS: These results demonstrate that Selaginella tamariscina may be a potent adjuvant therapeutic agent in the prevention of oral cancer. |
format | Online Article Text |
id | pubmed-3683067 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36830672013-06-24 Selaginella tamariscina Attenuates Metastasis via Akt Pathways in Oral Cancer Cells Yang, Jia-Sin Lin, Chiao-Wen Hsin, Chung-Han Hsieh, Ming-Ju Chang, Yu-Chao PLoS One Research Article BACKGROUND: Crude extracts of Selaginella tamariscina , an oriental medicinal herb, have been evidenced to treat several human diseases. This study investigated the mechanisms by which Selaginella tamariscina inhibits the invasiveness of human oral squamous-cell carcinoma (OSCC) HSC-3 cells. METHODOLOGY/PRINCIPAL FINDINGS: Herein, we demonstrate that Selaginella tamariscina attenuated HSC-3 cell migration and invasion in a dose-dependent manner. The anti-metastatic activities of Selaginella tamariscina occurred at least partially because of the down-regulation of matrix metalloproteinases (MMP)-2 and MMP-9 gelatinase activity and the down-regulation of protein expression. The expression and function of both MMP-2 and MMP-9 were regulated by Selaginella tamariscina at a transcriptional level, as shown by quantitative real-time PCR and reporter assays. Chromatin immunoprecipitation (ChIP) data further indicated that binding of the cAMP response element-binding (CREB) protein and activating protein-1 (AP-1) to the MMP-2 promoter diminished at the highest dosage level of Selaginella tamariscina . The DNA-binding activity of specificity protein 1 (SP-1) to the MMP-9 promoter was also suppressed at the same concentration. Selaginella tamariscina did not affect the mitogen-activated protein kinase signaling pathway, but did inhibit the effects of gelatinase by reducing the activation of serine–threonine kinase Akt. CONCLUSIONS: These results demonstrate that Selaginella tamariscina may be a potent adjuvant therapeutic agent in the prevention of oral cancer. Public Library of Science 2013-06-14 /pmc/articles/PMC3683067/ /pubmed/23799155 http://dx.doi.org/10.1371/journal.pone.0068035 Text en © 2013 Yang et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Yang, Jia-Sin Lin, Chiao-Wen Hsin, Chung-Han Hsieh, Ming-Ju Chang, Yu-Chao Selaginella tamariscina Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title |
Selaginella
tamariscina
Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title_full |
Selaginella
tamariscina
Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title_fullStr |
Selaginella
tamariscina
Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title_full_unstemmed |
Selaginella
tamariscina
Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title_short |
Selaginella
tamariscina
Attenuates Metastasis via Akt Pathways in Oral Cancer Cells |
title_sort | selaginella
tamariscina
attenuates metastasis via akt pathways in oral cancer cells |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3683067/ https://www.ncbi.nlm.nih.gov/pubmed/23799155 http://dx.doi.org/10.1371/journal.pone.0068035 |
work_keys_str_mv | AT yangjiasin selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT linchiaowen selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT hsinchunghan selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT hsiehmingju selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells AT changyuchao selaginellatamariscinaattenuatesmetastasisviaaktpathwaysinoralcancercells |