Cargando…

Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon

Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portio...

Descripción completa

Detalles Bibliográficos
Autores principales: Gabra, Nathalie, Belair, Manon, Ayad, Tareck
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3686063/
https://www.ncbi.nlm.nih.gov/pubmed/23862089
http://dx.doi.org/10.1155/2013/912628
_version_ 1782273750242164736
author Gabra, Nathalie
Belair, Manon
Ayad, Tareck
author_facet Gabra, Nathalie
Belair, Manon
Ayad, Tareck
author_sort Gabra, Nathalie
collection PubMed
description Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety.
format Online
Article
Text
id pubmed-3686063
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-36860632013-07-16 Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon Gabra, Nathalie Belair, Manon Ayad, Tareck Case Rep Otolaryngol Case Report Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety. Hindawi Publishing Corporation 2013 2013-06-03 /pmc/articles/PMC3686063/ /pubmed/23862089 http://dx.doi.org/10.1155/2013/912628 Text en Copyright © 2013 Nathalie Gabra et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Case Report
Gabra, Nathalie
Belair, Manon
Ayad, Tareck
Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_full Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_fullStr Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_full_unstemmed Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_short Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
title_sort retropharyngeal calcific tendinitis mimicking a retropharyngeal phlegmon
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3686063/
https://www.ncbi.nlm.nih.gov/pubmed/23862089
http://dx.doi.org/10.1155/2013/912628
work_keys_str_mv AT gabranathalie retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon
AT belairmanon retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon
AT ayadtareck retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon