Cargando…
Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon
Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portio...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3686063/ https://www.ncbi.nlm.nih.gov/pubmed/23862089 http://dx.doi.org/10.1155/2013/912628 |
_version_ | 1782273750242164736 |
---|---|
author | Gabra, Nathalie Belair, Manon Ayad, Tareck |
author_facet | Gabra, Nathalie Belair, Manon Ayad, Tareck |
author_sort | Gabra, Nathalie |
collection | PubMed |
description | Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety. |
format | Online Article Text |
id | pubmed-3686063 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-36860632013-07-16 Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon Gabra, Nathalie Belair, Manon Ayad, Tareck Case Rep Otolaryngol Case Report Background. Acute retropharyngeal tendinitis is a little known but not an uncommon condition. It was first described by Hartley in 1964 as an inflammation of the longus colli muscle secondary to calcium crystals deposition on its insertion. The calcifications are mostly located on the oblique portion of the muscle at the level of C1-C2. Methods. We will describe this disease through 4 cases that presented in our institution. Results. The most common symptoms are severe neck pain, odynophagia, and a painful restriction of neck movement. It is associated with mild fever and inflammatory lab findings such as a slight elevation of white blood cell count, erythrocyte sedimentation rate, and C-reactive protein. CT scan is recommended as the first-line imaging modality to establish a diagnosis. Treatments consist of NSAIDs and analgesics to accelerate the healing process. If symptoms are severe, a course of corticosteroids is required. Conclusion. Since the clinical and laboratory findings of this condition and those of a retropharyngeal abscess overlap, it is important to establish the right diagnosis in order to prevent more invasive procedures. A good knowledge of this clinical entity by otolaryngologists would prevent delays in hospital discharge and unnecessary anxiety. Hindawi Publishing Corporation 2013 2013-06-03 /pmc/articles/PMC3686063/ /pubmed/23862089 http://dx.doi.org/10.1155/2013/912628 Text en Copyright © 2013 Nathalie Gabra et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Case Report Gabra, Nathalie Belair, Manon Ayad, Tareck Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title | Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title_full | Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title_fullStr | Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title_full_unstemmed | Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title_short | Retropharyngeal Calcific Tendinitis Mimicking a Retropharyngeal Phlegmon |
title_sort | retropharyngeal calcific tendinitis mimicking a retropharyngeal phlegmon |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3686063/ https://www.ncbi.nlm.nih.gov/pubmed/23862089 http://dx.doi.org/10.1155/2013/912628 |
work_keys_str_mv | AT gabranathalie retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon AT belairmanon retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon AT ayadtareck retropharyngealcalcifictendinitismimickingaretropharyngealphlegmon |