Cargando…

The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids

The Madagascar periwinkle ( Catharanthus roseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often...

Descripción completa

Detalles Bibliográficos
Autores principales: Ku, Chuan, Chung, Wan-Chia, Chen, Ling-Ling, Kuo, Chih-Horng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3688999/
https://www.ncbi.nlm.nih.gov/pubmed/23825699
http://dx.doi.org/10.1371/journal.pone.0068518
_version_ 1782274214596706304
author Ku, Chuan
Chung, Wan-Chia
Chen, Ling-Ling
Kuo, Chih-Horng
author_facet Ku, Chuan
Chung, Wan-Chia
Chen, Ling-Ling
Kuo, Chih-Horng
author_sort Ku, Chuan
collection PubMed
description The Madagascar periwinkle ( Catharanthus roseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often used as the host for studies on phytoplasmas, an important group of uncultivated plant pathogens. To gain insights into the characteristics of apocynaceous plastid genomes (plastomes), we used a reference-assisted approach to assemble the complete plastome of C . roseus , which could be applied to other C . roseus -related studies. The C . roseus plastome is the second completely sequenced plastome in the asterid order Gentianales. We performed comparative analyses with two other representative sequences in the same order, including the complete plastome of Coffea arabica (from the basal Gentianales family Rubiaceae) and the nearly complete plastome of Asclepias syriaca (Apocynaceae). The results demonstrated considerable variations in gene content and plastome organization within Apocynaceae, including the presence/absence of three essential genes (i.e., accD, clpP, and ycf1) and large size changes in non-coding regions (e.g., rps2-rpoC2 and IRb-ndhF). To find plastome markers of potential utility for Catharanthus breeding and phylogenetic analyses, we identified 41 C . roseus -specific simple sequence repeats. Furthermore, five intergenic regions with high divergence between C . roseus and three other euasterids I taxa were identified as candidate markers. To resolve the euasterids I interordinal relationships, 82 plastome genes were used for phylogenetic inference. With the addition of representatives from Apocynaceae and sampling of most other asterid orders, a sister relationship between Gentianales and Solanales is supported.
format Online
Article
Text
id pubmed-3688999
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-36889992013-07-02 The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids Ku, Chuan Chung, Wan-Chia Chen, Ling-Ling Kuo, Chih-Horng PLoS One Research Article The Madagascar periwinkle ( Catharanthus roseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often used as the host for studies on phytoplasmas, an important group of uncultivated plant pathogens. To gain insights into the characteristics of apocynaceous plastid genomes (plastomes), we used a reference-assisted approach to assemble the complete plastome of C . roseus , which could be applied to other C . roseus -related studies. The C . roseus plastome is the second completely sequenced plastome in the asterid order Gentianales. We performed comparative analyses with two other representative sequences in the same order, including the complete plastome of Coffea arabica (from the basal Gentianales family Rubiaceae) and the nearly complete plastome of Asclepias syriaca (Apocynaceae). The results demonstrated considerable variations in gene content and plastome organization within Apocynaceae, including the presence/absence of three essential genes (i.e., accD, clpP, and ycf1) and large size changes in non-coding regions (e.g., rps2-rpoC2 and IRb-ndhF). To find plastome markers of potential utility for Catharanthus breeding and phylogenetic analyses, we identified 41 C . roseus -specific simple sequence repeats. Furthermore, five intergenic regions with high divergence between C . roseus and three other euasterids I taxa were identified as candidate markers. To resolve the euasterids I interordinal relationships, 82 plastome genes were used for phylogenetic inference. With the addition of representatives from Apocynaceae and sampling of most other asterid orders, a sister relationship between Gentianales and Solanales is supported. Public Library of Science 2013-06-18 /pmc/articles/PMC3688999/ /pubmed/23825699 http://dx.doi.org/10.1371/journal.pone.0068518 Text en © 2013 Ku et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Ku, Chuan
Chung, Wan-Chia
Chen, Ling-Ling
Kuo, Chih-Horng
The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title_full The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title_fullStr The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title_full_unstemmed The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title_short The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids
title_sort complete plastid genome sequence of madagascar periwinkle catharanthus roseus (l.) g. don: plastid genome evolution, molecular marker identification, and phylogenetic implications in asterids
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3688999/
https://www.ncbi.nlm.nih.gov/pubmed/23825699
http://dx.doi.org/10.1371/journal.pone.0068518
work_keys_str_mv AT kuchuan thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT chungwanchia thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT chenlingling thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT kuochihhorng thecompleteplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT kuchuan completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT chungwanchia completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT chenlingling completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids
AT kuochihhorng completeplastidgenomesequenceofmadagascarperiwinklecatharanthusroseuslgdonplastidgenomeevolutionmolecularmarkeridentificationandphylogeneticimplicationsinasterids