Cargando…
Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influ...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3691295/ https://www.ncbi.nlm.nih.gov/pubmed/23826131 http://dx.doi.org/10.1371/journal.pone.0066768 |
_version_ | 1782274454243508224 |
---|---|
author | Anderson, Laura N. Cotterchio, Michelle Knight, Julia A. Borgida, Ayelet Gallinger, Steven Cleary, Sean P. |
author_facet | Anderson, Laura N. Cotterchio, Michelle Knight, Julia A. Borgida, Ayelet Gallinger, Steven Cleary, Sean P. |
author_sort | Anderson, Laura N. |
collection | PubMed |
description | Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influence pancreatic cancer risk. The association between 87 single nucleotide polymorphisms (SNPs) in 11 genes was evaluated within the Ontario Pancreas Cancer Study, a population-based case-control study. Pancreatic cancer cases with pathology confirmed adenocarcinoma were identified from the Ontario Cancer Registry (n = 628) and controls were identified through random digit dialing (n = 1193). Age and sex adjusted odds ratios (OR) and 95% confidence intervals (CI) were estimated by multivariate logistic regression. SNPs in the CYP24A1, CYP2R1, calcium sensing receptor (CASR), vitamin D binding protein (GC), retinoid X receptor-alpha (RXRA) and megalin (LRP2) genes were significantly associated with pancreas cancer risk. For example, pancreas cancer risk was inversely associated with CYP2R1 rs10741657 (AA versus GG, OR = 0.70; 95%CI: 0.51–0.95) and positively with CYP24A1 rs6127119 (TT versus CC. OR = 1.94; 95%CI: 1.28–2.94). None of the associations were statistically significant after adjustment for multiple comparisons. Vitamin D pathway gene variants may be associated with pancreas cancer risk and future studies are needed to understand the possible role of vitamin D in tumorigenesis and may have implications for cancer-prevention strategies. |
format | Online Article Text |
id | pubmed-3691295 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36912952013-07-03 Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada Anderson, Laura N. Cotterchio, Michelle Knight, Julia A. Borgida, Ayelet Gallinger, Steven Cleary, Sean P. PLoS One Research Article Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influence pancreatic cancer risk. The association between 87 single nucleotide polymorphisms (SNPs) in 11 genes was evaluated within the Ontario Pancreas Cancer Study, a population-based case-control study. Pancreatic cancer cases with pathology confirmed adenocarcinoma were identified from the Ontario Cancer Registry (n = 628) and controls were identified through random digit dialing (n = 1193). Age and sex adjusted odds ratios (OR) and 95% confidence intervals (CI) were estimated by multivariate logistic regression. SNPs in the CYP24A1, CYP2R1, calcium sensing receptor (CASR), vitamin D binding protein (GC), retinoid X receptor-alpha (RXRA) and megalin (LRP2) genes were significantly associated with pancreas cancer risk. For example, pancreas cancer risk was inversely associated with CYP2R1 rs10741657 (AA versus GG, OR = 0.70; 95%CI: 0.51–0.95) and positively with CYP24A1 rs6127119 (TT versus CC. OR = 1.94; 95%CI: 1.28–2.94). None of the associations were statistically significant after adjustment for multiple comparisons. Vitamin D pathway gene variants may be associated with pancreas cancer risk and future studies are needed to understand the possible role of vitamin D in tumorigenesis and may have implications for cancer-prevention strategies. Public Library of Science 2013-06-24 /pmc/articles/PMC3691295/ /pubmed/23826131 http://dx.doi.org/10.1371/journal.pone.0066768 Text en © 2013 Anderson et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Anderson, Laura N. Cotterchio, Michelle Knight, Julia A. Borgida, Ayelet Gallinger, Steven Cleary, Sean P. Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title | Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title_full | Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title_fullStr | Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title_full_unstemmed | Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title_short | Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada |
title_sort | genetic variants in vitamin d pathway genes and risk of pancreas cancer; results from a population-based case-control study in ontario, canada |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3691295/ https://www.ncbi.nlm.nih.gov/pubmed/23826131 http://dx.doi.org/10.1371/journal.pone.0066768 |
work_keys_str_mv | AT andersonlauran geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada AT cotterchiomichelle geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada AT knightjuliaa geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada AT borgidaayelet geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada AT gallingersteven geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada AT clearyseanp geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada |