Cargando…

Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada

Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influ...

Descripción completa

Detalles Bibliográficos
Autores principales: Anderson, Laura N., Cotterchio, Michelle, Knight, Julia A., Borgida, Ayelet, Gallinger, Steven, Cleary, Sean P.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3691295/
https://www.ncbi.nlm.nih.gov/pubmed/23826131
http://dx.doi.org/10.1371/journal.pone.0066768
_version_ 1782274454243508224
author Anderson, Laura N.
Cotterchio, Michelle
Knight, Julia A.
Borgida, Ayelet
Gallinger, Steven
Cleary, Sean P.
author_facet Anderson, Laura N.
Cotterchio, Michelle
Knight, Julia A.
Borgida, Ayelet
Gallinger, Steven
Cleary, Sean P.
author_sort Anderson, Laura N.
collection PubMed
description Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influence pancreatic cancer risk. The association between 87 single nucleotide polymorphisms (SNPs) in 11 genes was evaluated within the Ontario Pancreas Cancer Study, a population-based case-control study. Pancreatic cancer cases with pathology confirmed adenocarcinoma were identified from the Ontario Cancer Registry (n = 628) and controls were identified through random digit dialing (n = 1193). Age and sex adjusted odds ratios (OR) and 95% confidence intervals (CI) were estimated by multivariate logistic regression. SNPs in the CYP24A1, CYP2R1, calcium sensing receptor (CASR), vitamin D binding protein (GC), retinoid X receptor-alpha (RXRA) and megalin (LRP2) genes were significantly associated with pancreas cancer risk. For example, pancreas cancer risk was inversely associated with CYP2R1 rs10741657 (AA versus GG, OR = 0.70; 95%CI: 0.51–0.95) and positively with CYP24A1 rs6127119 (TT versus CC. OR = 1.94; 95%CI: 1.28–2.94). None of the associations were statistically significant after adjustment for multiple comparisons. Vitamin D pathway gene variants may be associated with pancreas cancer risk and future studies are needed to understand the possible role of vitamin D in tumorigenesis and may have implications for cancer-prevention strategies.
format Online
Article
Text
id pubmed-3691295
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-36912952013-07-03 Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada Anderson, Laura N. Cotterchio, Michelle Knight, Julia A. Borgida, Ayelet Gallinger, Steven Cleary, Sean P. PLoS One Research Article Recent studies of 25-hydroxyvitamin D (25(OH)D) levels and pancreas cancer have suggested a potential role of the vitamin D pathway in the etiology of this fatal disease. Variants in vitamin-D related genes are known to affect 25(OH)D levels and function and it is unknown if these variants may influence pancreatic cancer risk. The association between 87 single nucleotide polymorphisms (SNPs) in 11 genes was evaluated within the Ontario Pancreas Cancer Study, a population-based case-control study. Pancreatic cancer cases with pathology confirmed adenocarcinoma were identified from the Ontario Cancer Registry (n = 628) and controls were identified through random digit dialing (n = 1193). Age and sex adjusted odds ratios (OR) and 95% confidence intervals (CI) were estimated by multivariate logistic regression. SNPs in the CYP24A1, CYP2R1, calcium sensing receptor (CASR), vitamin D binding protein (GC), retinoid X receptor-alpha (RXRA) and megalin (LRP2) genes were significantly associated with pancreas cancer risk. For example, pancreas cancer risk was inversely associated with CYP2R1 rs10741657 (AA versus GG, OR = 0.70; 95%CI: 0.51–0.95) and positively with CYP24A1 rs6127119 (TT versus CC. OR = 1.94; 95%CI: 1.28–2.94). None of the associations were statistically significant after adjustment for multiple comparisons. Vitamin D pathway gene variants may be associated with pancreas cancer risk and future studies are needed to understand the possible role of vitamin D in tumorigenesis and may have implications for cancer-prevention strategies. Public Library of Science 2013-06-24 /pmc/articles/PMC3691295/ /pubmed/23826131 http://dx.doi.org/10.1371/journal.pone.0066768 Text en © 2013 Anderson et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Anderson, Laura N.
Cotterchio, Michelle
Knight, Julia A.
Borgida, Ayelet
Gallinger, Steven
Cleary, Sean P.
Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title_full Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title_fullStr Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title_full_unstemmed Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title_short Genetic Variants in Vitamin D Pathway Genes and Risk of Pancreas Cancer; Results from a Population-Based Case-Control Study in Ontario, Canada
title_sort genetic variants in vitamin d pathway genes and risk of pancreas cancer; results from a population-based case-control study in ontario, canada
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3691295/
https://www.ncbi.nlm.nih.gov/pubmed/23826131
http://dx.doi.org/10.1371/journal.pone.0066768
work_keys_str_mv AT andersonlauran geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada
AT cotterchiomichelle geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada
AT knightjuliaa geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada
AT borgidaayelet geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada
AT gallingersteven geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada
AT clearyseanp geneticvariantsinvitamindpathwaygenesandriskofpancreascancerresultsfromapopulationbasedcasecontrolstudyinontariocanada