Cargando…
Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence
BACKGROUND: Heroin dependence is a debilitating psychiatric disorder with complex inheritance. Since the dopaminergic system has a key role in rewarding mechanism of the brain, which is directly or indirectly targeted by most drugs of abuse, we focus on the effects and interactions among dopaminergi...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3696122/ https://www.ncbi.nlm.nih.gov/pubmed/23840506 http://dx.doi.org/10.1371/journal.pone.0066592 |
_version_ | 1782476293073272832 |
---|---|
author | Vereczkei, Andrea Demetrovics, Zsolt Szekely, Anna Sarkozy, Peter Antal, Peter Szilagyi, Agnes Sasvari-Szekely, Maria Barta, Csaba |
author_facet | Vereczkei, Andrea Demetrovics, Zsolt Szekely, Anna Sarkozy, Peter Antal, Peter Szilagyi, Agnes Sasvari-Szekely, Maria Barta, Csaba |
author_sort | Vereczkei, Andrea |
collection | PubMed |
description | BACKGROUND: Heroin dependence is a debilitating psychiatric disorder with complex inheritance. Since the dopaminergic system has a key role in rewarding mechanism of the brain, which is directly or indirectly targeted by most drugs of abuse, we focus on the effects and interactions among dopaminergic gene variants. OBJECTIVE: To study the potential association between allelic variants of dopamine D2 receptor (DRD2), ANKK1 (ankyrin repeat and kinase domain containing 1), dopamine D4 receptor (DRD4), catechol-O-methyl transferase (COMT) and dopamine transporter (SLC6A3) genes and heroin dependence in Hungarian patients. METHODS: 303 heroin dependent subjects and 555 healthy controls were genotyped for 7 single nucleotide polymorphisms (SNPs) rs4680 of the COMT gene; rs1079597 and rs1800498 of the DRD2 gene; rs1800497 of the ANKK1 gene; rs1800955, rs936462 and rs747302 of the DRD4 gene. Four variable number of tandem repeats (VNTRs) were also genotyped: 120 bp duplication and 48 bp VNTR in exon 3 of DRD4 and 40 bp VNTR and intron 8 VNTR of SLC6A3. We also perform a multivariate analysis of associations using Bayesian networks in Bayesian multilevel analysis (BN-BMLA). FINDINGS AND CONCLUSIONS: In single marker analysis the TaqIA (rs1800497) and TaqIB (rs1079597) variants were associated with heroin dependence. Moreover, –521 C/T SNP (rs1800955) of the DRD4 gene showed nominal association with a possible protective effect of the C allele. After applying the Bonferroni correction TaqIB was still significant suggesting that the minor (A) allele of the TaqIB SNP is a risk component in the genetic background of heroin dependence. The findings of the additional multiple marker analysis are consistent with the results of the single marker analysis, but this method was able to reveal an indirect effect of a promoter polymorphism (rs936462) of the DRD4 gene and this effect is mediated through the –521 C/T (rs1800955) polymorphism in the promoter. |
format | Online Article Text |
id | pubmed-3696122 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-36961222013-07-09 Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence Vereczkei, Andrea Demetrovics, Zsolt Szekely, Anna Sarkozy, Peter Antal, Peter Szilagyi, Agnes Sasvari-Szekely, Maria Barta, Csaba PLoS One Research Article BACKGROUND: Heroin dependence is a debilitating psychiatric disorder with complex inheritance. Since the dopaminergic system has a key role in rewarding mechanism of the brain, which is directly or indirectly targeted by most drugs of abuse, we focus on the effects and interactions among dopaminergic gene variants. OBJECTIVE: To study the potential association between allelic variants of dopamine D2 receptor (DRD2), ANKK1 (ankyrin repeat and kinase domain containing 1), dopamine D4 receptor (DRD4), catechol-O-methyl transferase (COMT) and dopamine transporter (SLC6A3) genes and heroin dependence in Hungarian patients. METHODS: 303 heroin dependent subjects and 555 healthy controls were genotyped for 7 single nucleotide polymorphisms (SNPs) rs4680 of the COMT gene; rs1079597 and rs1800498 of the DRD2 gene; rs1800497 of the ANKK1 gene; rs1800955, rs936462 and rs747302 of the DRD4 gene. Four variable number of tandem repeats (VNTRs) were also genotyped: 120 bp duplication and 48 bp VNTR in exon 3 of DRD4 and 40 bp VNTR and intron 8 VNTR of SLC6A3. We also perform a multivariate analysis of associations using Bayesian networks in Bayesian multilevel analysis (BN-BMLA). FINDINGS AND CONCLUSIONS: In single marker analysis the TaqIA (rs1800497) and TaqIB (rs1079597) variants were associated with heroin dependence. Moreover, –521 C/T SNP (rs1800955) of the DRD4 gene showed nominal association with a possible protective effect of the C allele. After applying the Bonferroni correction TaqIB was still significant suggesting that the minor (A) allele of the TaqIB SNP is a risk component in the genetic background of heroin dependence. The findings of the additional multiple marker analysis are consistent with the results of the single marker analysis, but this method was able to reveal an indirect effect of a promoter polymorphism (rs936462) of the DRD4 gene and this effect is mediated through the –521 C/T (rs1800955) polymorphism in the promoter. Public Library of Science 2013-06-28 /pmc/articles/PMC3696122/ /pubmed/23840506 http://dx.doi.org/10.1371/journal.pone.0066592 Text en © 2013 Vereczkei et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Vereczkei, Andrea Demetrovics, Zsolt Szekely, Anna Sarkozy, Peter Antal, Peter Szilagyi, Agnes Sasvari-Szekely, Maria Barta, Csaba Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title | Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title_full | Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title_fullStr | Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title_full_unstemmed | Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title_short | Multivariate Analysis of Dopaminergic Gene Variants as Risk Factors of Heroin Dependence |
title_sort | multivariate analysis of dopaminergic gene variants as risk factors of heroin dependence |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3696122/ https://www.ncbi.nlm.nih.gov/pubmed/23840506 http://dx.doi.org/10.1371/journal.pone.0066592 |
work_keys_str_mv | AT vereczkeiandrea multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT demetrovicszsolt multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT szekelyanna multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT sarkozypeter multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT antalpeter multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT szilagyiagnes multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT sasvariszekelymaria multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence AT bartacsaba multivariateanalysisofdopaminergicgenevariantsasriskfactorsofheroindependence |