Cargando…
Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia
A cross-sectional study was conducted to assess the prevalence and correlates of prenatal vitamin A deficiency (VAD) in rural Sidama, Southern Ethiopia. Seven hundred randomly-selected pregnant women took part in the study. Serum retinol concentration was determined using high-performance liquid chr...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
International Centre for Diarrhoeal Disease Research, Bangladesh
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3702339/ https://www.ncbi.nlm.nih.gov/pubmed/23930336 |
_version_ | 1782275788390793216 |
---|---|
author | Gebreselassie, Samson Gebremedhin Gase, Fikre Enquselassie Deressa, Melaku Umeta |
author_facet | Gebreselassie, Samson Gebremedhin Gase, Fikre Enquselassie Deressa, Melaku Umeta |
author_sort | Gebreselassie, Samson Gebremedhin |
collection | PubMed |
description | A cross-sectional study was conducted to assess the prevalence and correlates of prenatal vitamin A deficiency (VAD) in rural Sidama, Southern Ethiopia. Seven hundred randomly-selected pregnant women took part in the study. Serum retinol concentration was determined using high-performance liquid chromatography. Data were analyzed by logistic and linear regression. Interpretation of data was made using adjusted odds ratio (AOR) and adjusted linear regression coefficient. The prevalence of VAD (serum retinol <0.7 µmol/L) was 37.9%. Advanced gestational age and elevated C-reactive protein (CRP ≥5 mg/dL) were negatively associated with retinol concentration (p<0.05). The odds of VAD was significantly higher among the women with no education and those devoid of self-income. Women aged 35-49 years had 2.23 (95% CI 1.31-3.81) times higher odds compared to those aged 15-24 years. The lower the dietary diversity score in the preceding day of the survey, the higher were the odds of VAD. With reference to nulliparas, grand multiparas had 1.92 (95% CI 1.02-3.64) times increased odds of VAD. VAD and zinc deficiency (serum zinc <8.6 µmol/L during the first trimester, or <7.6 µmol/L during the second or third trimester) were significantly associated with AOR of 1.80 (95% CI 1.28-2.53). VAD has major public-health significance in the area. Accordingly, it should be combated through enhancement of diet diversity, birth control, and socioeconomic empowerment of women. |
format | Online Article Text |
id | pubmed-3702339 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | International Centre for Diarrhoeal Disease Research, Bangladesh |
record_format | MEDLINE/PubMed |
spelling | pubmed-37023392013-07-24 Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia Gebreselassie, Samson Gebremedhin Gase, Fikre Enquselassie Deressa, Melaku Umeta J Health Popul Nutr Original Papers A cross-sectional study was conducted to assess the prevalence and correlates of prenatal vitamin A deficiency (VAD) in rural Sidama, Southern Ethiopia. Seven hundred randomly-selected pregnant women took part in the study. Serum retinol concentration was determined using high-performance liquid chromatography. Data were analyzed by logistic and linear regression. Interpretation of data was made using adjusted odds ratio (AOR) and adjusted linear regression coefficient. The prevalence of VAD (serum retinol <0.7 µmol/L) was 37.9%. Advanced gestational age and elevated C-reactive protein (CRP ≥5 mg/dL) were negatively associated with retinol concentration (p<0.05). The odds of VAD was significantly higher among the women with no education and those devoid of self-income. Women aged 35-49 years had 2.23 (95% CI 1.31-3.81) times higher odds compared to those aged 15-24 years. The lower the dietary diversity score in the preceding day of the survey, the higher were the odds of VAD. With reference to nulliparas, grand multiparas had 1.92 (95% CI 1.02-3.64) times increased odds of VAD. VAD and zinc deficiency (serum zinc <8.6 µmol/L during the first trimester, or <7.6 µmol/L during the second or third trimester) were significantly associated with AOR of 1.80 (95% CI 1.28-2.53). VAD has major public-health significance in the area. Accordingly, it should be combated through enhancement of diet diversity, birth control, and socioeconomic empowerment of women. International Centre for Diarrhoeal Disease Research, Bangladesh 2013-06 /pmc/articles/PMC3702339/ /pubmed/23930336 Text en © INTERNATIONAL CENTRE FOR DIARRHOEAL DISEASE RESEARCH, BANGLADESH http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Papers Gebreselassie, Samson Gebremedhin Gase, Fikre Enquselassie Deressa, Melaku Umeta Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title | Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title_full | Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title_fullStr | Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title_full_unstemmed | Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title_short | Prevalence and Correlates of Prenatal Vitamin A Deficiency in Rural Sidama, Southern Ethiopia |
title_sort | prevalence and correlates of prenatal vitamin a deficiency in rural sidama, southern ethiopia |
topic | Original Papers |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3702339/ https://www.ncbi.nlm.nih.gov/pubmed/23930336 |
work_keys_str_mv | AT gebreselassiesamsongebremedhin prevalenceandcorrelatesofprenatalvitaminadeficiencyinruralsidamasouthernethiopia AT gasefikreenquselassie prevalenceandcorrelatesofprenatalvitaminadeficiencyinruralsidamasouthernethiopia AT deressamelakuumeta prevalenceandcorrelatesofprenatalvitaminadeficiencyinruralsidamasouthernethiopia |