Cargando…

Analysis of elite variety tag SNPs reveals an important allele in upland rice

Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice vari...

Descripción completa

Detalles Bibliográficos
Autores principales: Lyu, Jun, Zhang, Shilai, Dong, Yang, He, Weiming, Zhang, Jing, Deng, Xianneng, Zhang, Yesheng, Li, Xin, Li, Baoye, Huang, Wangqi, Wan, Wenting, Yu, Yang, Li, Qiong, Li, Jun, Liu, Xin, Wang, Bo, Tao, Dayun, Zhang, Gengyun, Wang, Jun, Xu, Xun, Hu, Fengyi, Wang, Wen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Pub. Group 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3715847/
https://www.ncbi.nlm.nih.gov/pubmed/23828614
http://dx.doi.org/10.1038/ncomms3138
_version_ 1782277511048069120
author Lyu, Jun
Zhang, Shilai
Dong, Yang
He, Weiming
Zhang, Jing
Deng, Xianneng
Zhang, Yesheng
Li, Xin
Li, Baoye
Huang, Wangqi
Wan, Wenting
Yu, Yang
Li, Qiong
Li, Jun
Liu, Xin
Wang, Bo
Tao, Dayun
Zhang, Gengyun
Wang, Jun
Xu, Xun
Hu, Fengyi
Wang, Wen
author_facet Lyu, Jun
Zhang, Shilai
Dong, Yang
He, Weiming
Zhang, Jing
Deng, Xianneng
Zhang, Yesheng
Li, Xin
Li, Baoye
Huang, Wangqi
Wan, Wenting
Yu, Yang
Li, Qiong
Li, Jun
Liu, Xin
Wang, Bo
Tao, Dayun
Zhang, Gengyun
Wang, Jun
Xu, Xun
Hu, Fengyi
Wang, Wen
author_sort Lyu, Jun
collection PubMed
description Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice varieties and use two large control panels to identify elite variety tag single-nucleotide polymorphism alleles (ETASs). Guided by this preliminary analysis, we comprehensively characterize one protein-altering ETAS in the 9-cis-epoxycarotenoid dioxygenase gene of the IRAT104 upland rice variety. This allele displays a drastic frequency difference between upland and irrigated rice, and a selective sweep is observed around this allele. Functional analysis indicates that in upland rice, this allele is associated with significantly higher abscisic acid levels and denser lateral roots, suggesting its association with upland rice suitability. This report provides a potential strategy to mine rare, agronomically important alleles.
format Online
Article
Text
id pubmed-3715847
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Nature Pub. Group
record_format MEDLINE/PubMed
spelling pubmed-37158472013-07-19 Analysis of elite variety tag SNPs reveals an important allele in upland rice Lyu, Jun Zhang, Shilai Dong, Yang He, Weiming Zhang, Jing Deng, Xianneng Zhang, Yesheng Li, Xin Li, Baoye Huang, Wangqi Wan, Wenting Yu, Yang Li, Qiong Li, Jun Liu, Xin Wang, Bo Tao, Dayun Zhang, Gengyun Wang, Jun Xu, Xun Hu, Fengyi Wang, Wen Nat Commun Article Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice varieties and use two large control panels to identify elite variety tag single-nucleotide polymorphism alleles (ETASs). Guided by this preliminary analysis, we comprehensively characterize one protein-altering ETAS in the 9-cis-epoxycarotenoid dioxygenase gene of the IRAT104 upland rice variety. This allele displays a drastic frequency difference between upland and irrigated rice, and a selective sweep is observed around this allele. Functional analysis indicates that in upland rice, this allele is associated with significantly higher abscisic acid levels and denser lateral roots, suggesting its association with upland rice suitability. This report provides a potential strategy to mine rare, agronomically important alleles. Nature Pub. Group 2013-07-05 /pmc/articles/PMC3715847/ /pubmed/23828614 http://dx.doi.org/10.1038/ncomms3138 Text en Copyright © 2013, Nature Publishing Group, a division of Macmillan Publishers Limited. All Rights Reserved. http://creativecommons.org/licenses/by-nc-nd/3.0/ This work is licensed under a Creative Commons Attribution-NonCommercial-NoDerivative Works 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-nd/3.0/
spellingShingle Article
Lyu, Jun
Zhang, Shilai
Dong, Yang
He, Weiming
Zhang, Jing
Deng, Xianneng
Zhang, Yesheng
Li, Xin
Li, Baoye
Huang, Wangqi
Wan, Wenting
Yu, Yang
Li, Qiong
Li, Jun
Liu, Xin
Wang, Bo
Tao, Dayun
Zhang, Gengyun
Wang, Jun
Xu, Xun
Hu, Fengyi
Wang, Wen
Analysis of elite variety tag SNPs reveals an important allele in upland rice
title Analysis of elite variety tag SNPs reveals an important allele in upland rice
title_full Analysis of elite variety tag SNPs reveals an important allele in upland rice
title_fullStr Analysis of elite variety tag SNPs reveals an important allele in upland rice
title_full_unstemmed Analysis of elite variety tag SNPs reveals an important allele in upland rice
title_short Analysis of elite variety tag SNPs reveals an important allele in upland rice
title_sort analysis of elite variety tag snps reveals an important allele in upland rice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3715847/
https://www.ncbi.nlm.nih.gov/pubmed/23828614
http://dx.doi.org/10.1038/ncomms3138
work_keys_str_mv AT lyujun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT zhangshilai analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT dongyang analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT heweiming analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT zhangjing analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT dengxianneng analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT zhangyesheng analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT lixin analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT libaoye analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT huangwangqi analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT wanwenting analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT yuyang analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT liqiong analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT lijun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT liuxin analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT wangbo analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT taodayun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT zhanggengyun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT wangjun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT xuxun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT hufengyi analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice
AT wangwen analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice