Cargando…
Analysis of elite variety tag SNPs reveals an important allele in upland rice
Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice vari...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Pub. Group
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3715847/ https://www.ncbi.nlm.nih.gov/pubmed/23828614 http://dx.doi.org/10.1038/ncomms3138 |
_version_ | 1782277511048069120 |
---|---|
author | Lyu, Jun Zhang, Shilai Dong, Yang He, Weiming Zhang, Jing Deng, Xianneng Zhang, Yesheng Li, Xin Li, Baoye Huang, Wangqi Wan, Wenting Yu, Yang Li, Qiong Li, Jun Liu, Xin Wang, Bo Tao, Dayun Zhang, Gengyun Wang, Jun Xu, Xun Hu, Fengyi Wang, Wen |
author_facet | Lyu, Jun Zhang, Shilai Dong, Yang He, Weiming Zhang, Jing Deng, Xianneng Zhang, Yesheng Li, Xin Li, Baoye Huang, Wangqi Wan, Wenting Yu, Yang Li, Qiong Li, Jun Liu, Xin Wang, Bo Tao, Dayun Zhang, Gengyun Wang, Jun Xu, Xun Hu, Fengyi Wang, Wen |
author_sort | Lyu, Jun |
collection | PubMed |
description | Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice varieties and use two large control panels to identify elite variety tag single-nucleotide polymorphism alleles (ETASs). Guided by this preliminary analysis, we comprehensively characterize one protein-altering ETAS in the 9-cis-epoxycarotenoid dioxygenase gene of the IRAT104 upland rice variety. This allele displays a drastic frequency difference between upland and irrigated rice, and a selective sweep is observed around this allele. Functional analysis indicates that in upland rice, this allele is associated with significantly higher abscisic acid levels and denser lateral roots, suggesting its association with upland rice suitability. This report provides a potential strategy to mine rare, agronomically important alleles. |
format | Online Article Text |
id | pubmed-3715847 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Nature Pub. Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-37158472013-07-19 Analysis of elite variety tag SNPs reveals an important allele in upland rice Lyu, Jun Zhang, Shilai Dong, Yang He, Weiming Zhang, Jing Deng, Xianneng Zhang, Yesheng Li, Xin Li, Baoye Huang, Wangqi Wan, Wenting Yu, Yang Li, Qiong Li, Jun Liu, Xin Wang, Bo Tao, Dayun Zhang, Gengyun Wang, Jun Xu, Xun Hu, Fengyi Wang, Wen Nat Commun Article Elite crop varieties usually fix alleles that occur at low frequencies within non-elite gene pools. Dissecting these alleles for desirable agronomic traits can be accomplished by comparing the genomes of elite varieties with those from non-elite populations. Here we deep-sequence six elite rice varieties and use two large control panels to identify elite variety tag single-nucleotide polymorphism alleles (ETASs). Guided by this preliminary analysis, we comprehensively characterize one protein-altering ETAS in the 9-cis-epoxycarotenoid dioxygenase gene of the IRAT104 upland rice variety. This allele displays a drastic frequency difference between upland and irrigated rice, and a selective sweep is observed around this allele. Functional analysis indicates that in upland rice, this allele is associated with significantly higher abscisic acid levels and denser lateral roots, suggesting its association with upland rice suitability. This report provides a potential strategy to mine rare, agronomically important alleles. Nature Pub. Group 2013-07-05 /pmc/articles/PMC3715847/ /pubmed/23828614 http://dx.doi.org/10.1038/ncomms3138 Text en Copyright © 2013, Nature Publishing Group, a division of Macmillan Publishers Limited. All Rights Reserved. http://creativecommons.org/licenses/by-nc-nd/3.0/ This work is licensed under a Creative Commons Attribution-NonCommercial-NoDerivative Works 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-nd/3.0/ |
spellingShingle | Article Lyu, Jun Zhang, Shilai Dong, Yang He, Weiming Zhang, Jing Deng, Xianneng Zhang, Yesheng Li, Xin Li, Baoye Huang, Wangqi Wan, Wenting Yu, Yang Li, Qiong Li, Jun Liu, Xin Wang, Bo Tao, Dayun Zhang, Gengyun Wang, Jun Xu, Xun Hu, Fengyi Wang, Wen Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title | Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title_full | Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title_fullStr | Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title_full_unstemmed | Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title_short | Analysis of elite variety tag SNPs reveals an important allele in upland rice |
title_sort | analysis of elite variety tag snps reveals an important allele in upland rice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3715847/ https://www.ncbi.nlm.nih.gov/pubmed/23828614 http://dx.doi.org/10.1038/ncomms3138 |
work_keys_str_mv | AT lyujun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT zhangshilai analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT dongyang analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT heweiming analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT zhangjing analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT dengxianneng analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT zhangyesheng analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT lixin analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT libaoye analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT huangwangqi analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT wanwenting analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT yuyang analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT liqiong analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT lijun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT liuxin analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT wangbo analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT taodayun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT zhanggengyun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT wangjun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT xuxun analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT hufengyi analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice AT wangwen analysisofelitevarietytagsnpsrevealsanimportantalleleinuplandrice |