A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics

We consider the second order wave equation in an unbounded domain and propose an advanced perfectly matched layer (PML) technique for its efficient and reliable simulation. In doing so, we concentrate on the time domain case and use the finite-element (FE) method for the space discretization. Our un...

Descripción completa

Detalles Bibliográficos
Autores principales: Kaltenbacher, Barbara, Kaltenbacher, Manfred, Sim, Imbo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Academic Press 2013
Materias:
Article
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3719215/
https://www.ncbi.nlm.nih.gov/pubmed/23888085
http://dx.doi.org/10.1016/j.jcp.2012.10.016
_version_ 1782277878310764544
author Kaltenbacher, Barbara
Kaltenbacher, Manfred
Sim, Imbo
author_facet Kaltenbacher, Barbara
Kaltenbacher, Manfred
Sim, Imbo
author_sort Kaltenbacher, Barbara
collection PubMed
description We consider the second order wave equation in an unbounded domain and propose an advanced perfectly matched layer (PML) technique for its efficient and reliable simulation. In doing so, we concentrate on the time domain case and use the finite-element (FE) method for the space discretization. Our un-split-PML formulation requires four auxiliary variables within the PML region in three space dimensions. For a reduced version (rPML), we present a long time stability proof based on an energy analysis. The numerical case studies and an application example demonstrate the good performance and long time stability of our formulation for treating open domain problems.
format Online
Article
Text
id pubmed-3719215
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Academic Press
record_format MEDLINE/PubMed
spelling pubmed-37192152013-07-23 A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics Kaltenbacher, Barbara Kaltenbacher, Manfred Sim, Imbo J Comput Phys Article We consider the second order wave equation in an unbounded domain and propose an advanced perfectly matched layer (PML) technique for its efficient and reliable simulation. In doing so, we concentrate on the time domain case and use the finite-element (FE) method for the space discretization. Our un-split-PML formulation requires four auxiliary variables within the PML region in three space dimensions. For a reduced version (rPML), we present a long time stability proof based on an energy analysis. The numerical case studies and an application example demonstrate the good performance and long time stability of our formulation for treating open domain problems. Academic Press 2013-02-15 /pmc/articles/PMC3719215/ /pubmed/23888085 http://dx.doi.org/10.1016/j.jcp.2012.10.016 Text en © 2013 Elsevier Inc. https://creativecommons.org/licenses/by-nc-nd/3.0/ Open Access under CC BY-NC-ND 3.0 (https://creativecommons.org/licenses/by-nc-nd/3.0/) license
spellingShingle Article
Kaltenbacher, Barbara
Kaltenbacher, Manfred
Sim, Imbo
A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title_full A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title_fullStr A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title_full_unstemmed A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title_short A modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
title_sort modified and stable version of a perfectly matched layer technique for the 3-d second order wave equation in time domain with an application to aeroacoustics
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3719215/
https://www.ncbi.nlm.nih.gov/pubmed/23888085
http://dx.doi.org/10.1016/j.jcp.2012.10.016
work_keys_str_mv AT kaltenbacherbarbara amodifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics
AT kaltenbachermanfred amodifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics
AT simimbo amodifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics
AT kaltenbacherbarbara modifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics
AT kaltenbachermanfred modifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics
AT simimbo modifiedandstableversionofaperfectlymatchedlayertechniqueforthe3dsecondorderwaveequationintimedomainwithanapplicationtoaeroacoustics

Ejemplares similares